Welcome to MalwareRemoval.com,
What if we told you that you could get malware removal help from experts, and that it was 100% free? MalwareRemoval.com provides free support for people with infected computers. Our help, and the tools we use are always 100% free. No hidden catch. We simply enjoy helping others. You enjoy a clean, safe computer.

Malware Removal Instructions

searchqu as main page and explorer doesnt work

MalwareRemoval.com provides free support for people with infected computers. Using plain language that anyone can understand, our community of volunteer experts will walk you through each step.

searchqu as main page and explorer doesnt work

Unread postby Doomviolence » July 23rd, 2011, 10:02 pm

internet explorer doesnt open and i cant change the starting page of firefox and chrome. It always opens in the page "http://www.searchqu.com/406"

DDS (Ver_2011-06-23.01) - NTFSAMD64
Internet Explorer: 9.0.8112.16421 BrowserJavaVersion: 1.6.0_26
Run by Dun at 21:18:45 on 2011-07-23
Microsoft Windows 7 Home Premium 6.1.7600.0.1252.58.3082.18.8183.5725 [GMT -4,5:30]
AV: McAfee Anti-Virus y Anti-Spyware *Enabled/Updated* {86355677-4064-3EA7-ABB3-1B136EB04637}
SP: Windows Defender *Enabled/Updated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
SP: McAfee Anti-Virus y Anti-Spyware *Enabled/Updated* {3D54B793-665E-3129-9103-206115370C8A}
FW: McAfee Firewall *Enabled* {BE0ED752-0A0B-3FFF-80EC-B2269063014C}
============== Running Processes ===============
C:\Windows\system32\svchost.exe -k DcomLaunch
C:\Windows\system32\svchost.exe -k RPCSS
C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
C:\Windows\system32\svchost.exe -k netsvcs
C:\Program Files (x86)\Common Files\logishrd\LVMVFM\UMVPFSrv.exe
C:\Windows\system32\svchost.exe -k LocalService
C:\Program Files\Dell\DellDock\DockLogin.exe
C:\Windows\system32\svchost.exe -k NetworkService
C:\Windows\system32\svchost.exe -k LocalServiceNoNetwork
C:\Program Files (x86)\Hi-Rez Studios\HiPatchService.exe
C:\Windows\SysWOW64\svchost.exe -k hpdevmgmt
C:\Program Files\Common Files\Logishrd\LVMVFM\LVPrcSrv.exe
C:\Program Files\Common Files\McAfee\SystemCore\mfevtps.exe
C:\Program Files (x86)\Common Files\Logishrd\LVMVFM\LVPrS64H.exe
c:\Program Files\Microsoft SQL Server\MSSQL10.SQLEXPRESS\MSSQL\Binn\sqlservr.exe
C:\Windows\System32\svchost.exe -k HPZ12
C:\Windows\System32\svchost.exe -k HPZ12
C:\Program Files (x86)\Microsoft\BingBar\SeaPort.EXE
C:\Program Files (x86)\Dell DataSafe Local Backup\sftservice.EXE
c:\Program Files\Microsoft SQL Server\90\Shared\sqlwriter.exe
C:\Windows\system32\svchost.exe -k imgsvc
C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSVC.EXE
C:\Program Files\Common Files\McAfee\SystemCore\mcshield.exe
C:\Program Files\Common Files\McAfee\SystemCore\mfefire.exe
C:\Program Files (x86)\Dell DataSafe Local Backup\Components\DSUpdate\DSUpd.exe
C:\Program Files (x86)\Dell DataSafe Local Backup\COMPONENTS\SCHEDULER\STSERVICE.EXE
C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSvcM.exe
C:\Program Files (x86)\Dell DataSafe Local Backup\Toaster.exe
C:\Program Files\Common Files\McAfee\McSvcHost\McSvHost.exe
C:\Windows\system32\svchost.exe -k HPService
C:\Windows\system32\svchost.exe -k NetworkServiceNetworkRestricted
C:\Program Files\Realtek\Audio\HDA\RAVCpl64.exe
C:\Program Files (x86)\Windows Live\Messenger\msnmsgr.exe
C:\Program Files (x86)\Rockstar Games\Rockstar Games Social Club\1_0_0_0\RGSC.exe
C:\Program Files (x86)\Logitech\Vid HD\Vid.exe
C:\Program Files (x86)\Steam\Steam.exe
C:\Windows\system32\svchost.exe -k LocalServiceAndNoImpersonation
C:\Program Files (x86)\Skype\Phone\Skype.exe
C:\Program Files (x86)\HP\Digital Imaging\bin\hpqtra08.exe
C:\Program Files (x86)\McAfee Security Scan\2.0.181\SSScheduler.exe
C:\Program Files (x86)\Intel\Intel(R) Rapid Storage Technology\IAStorIcon.exe
C:\Program Files (x86)\Dell DataSafe Online\DataSafeOnline.exe
C:\Program Files\mcafee.com\agent\mcagent.exe
C:\Program Files (x86)\CyberLink\PowerDVD9\PDVD9Serv.exe
C:\Program Files (x86)\CyberLink\Shared files\brs.exe
C:\Program Files (x86)\Common Files\Adobe\ARM\1.0\AdobeARM.exe
C:\Program Files (x86)\HP\HP Software Update\hpwuSchd2.exe
C:\Program Files (x86)\Logitech\LWS\Webcam Software\LWS.exe
C:\Program Files (x86)\Common Files\Java\Java Update\jusched.exe
C:\Program Files (x86)\Windows iLivid Toolbar\Datamngr\datamngrUI.exe
C:\Program Files (x86)\Logitech\LWS\Webcam Software\CameraHelperShell.exe
C:\Program Files (x86)\HP\Digital Imaging\bin\hpqSTE08.exe
C:\Program Files (x86)\Common Files\Logishrd\LQCVFX\COCIManager.exe
C:\Program Files (x86)\HP\Digital Imaging\bin\hpqbam08.exe
C:\Program Files (x86)\HP\Digital Imaging\bin\hpqgpc01.exe
C:\Program Files (x86)\Common Files\Steam\SteamService.exe
C:\Program Files (x86)\Intel\Intel(R) Rapid Storage Technology\IAStorDataMgrSvc.exe
C:\Windows\System32\svchost.exe -k secsvcs
C:\ProgramData\Firefly Studios\Stronghold Kingdoms\\StrongholdKingdoms.exe
C:\Program Files (x86)\Adobe\Reader 9.0\Reader\AcroRd32.exe
C:\Program Files (x86)\Common Files\Adobe\CS5ServiceManager\CS5ServiceManager.exe
C:\Program Files (x86)\Adobe\Adobe Flash CS5\Flash.exe
c:\program files (x86)\adobe\adobe help\adobe help.exe
============== Pseudo HJT Report ===============
uStart Page = hxxp://www.searchqu.com/406
uDefault_Page_URL = hxxp://www1.la.dell.com/content/default ... l=es&s=gen
mWinlogon: Userinit=userinit.exe
BHO: HP Print Enhancer: {0347c33e-8762-4905-bf09-768834316c61} - C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\hpswp_printenhancer.dll
BHO: Adobe PDF Link Helper: {18df081c-e8ad-4283-a596-fa578c2ebdc3} - C:\Program Files (x86)\Common Files\Adobe\Acrobat\ActiveX\AcroIEHelperShim.dll
BHO: Babylon toolbar helper: {2eecd738-5844-4a99-b4b6-146bf802613b} - C:\Program Files (x86)\BabylonToolbar\BabylonToolbar\\bh\BabylonToolbar.dll
BHO: Groove GFS Browser Helper: {72853161-30c5-4d22-b7f9-0bbc1d38a37e} - C:\PROGRA~2\MIF5BA~1\Office14\GROOVEEX.DLL
BHO: scriptproxy: {7db2d5a0-7241-4e79-b68d-6309f01c5231} - C:\Program Files (x86)\Common Files\McAfee\SystemCore\ScriptSn.20110512153213.dll
BHO: Aplicación auxiliar de inicio de sesión de Windows Live ID: {9030d464-4c02-4abf-8ecc-5164760863c6} - C:\Program Files (x86)\Common Files\Microsoft Shared\Windows Live\WindowsLiveLogin.dll
BHO: Searchqu Toolbar: {99079a25-328f-4bd4-be04-00955acaa0a7} - C:\PROGRA~2\WI3C8A~1\Datamngr\ToolBar\searchqudtx.dll
BHO: Windows Live Messenger Companion Helper: {9fdde16b-836f-4806-ab1f-1455cbeff289} - C:\Program Files (x86)\Windows Live\Companion\companioncore.dll
BHO: UrlHelper Class: {a40dc6c5-79d0-4ca8-a185-8ff989af1115} - C:\PROGRA~2\WI3C8A~1\Datamngr\IEBHO.dll
BHO: Skype Browser Helper: {ae805869-2e5c-4ed4-8f7b-f1f7851a4497} - C:\Program Files (x86)\Skype\Toolbars\Internet Explorer\skypeieplugin.dll
BHO: FlashGetBHO: {b070d3e3-fec0-47d9-8e8a-99d4eeb3d3b0} - C:\Users\Dun\AppData\Roaming\FlashGetBHO\FlashGetBHO3.dll
BHO: Office Document Cache Handler: {b4f3a835-0e21-4959-ba22-42b3008e02ff} - C:\PROGRA~2\MIF5BA~1\Office14\URLREDIR.DLL
BHO: Bing Bar Helper: {d2ce3e00-f94a-4740-988e-03dc2f38c34f} - "C:\Program Files (x86)\Microsoft\BingBar\BingExt.dll"
BHO: Java(tm) Plug-In 2 SSV Helper: {dbc80044-a445-435b-bc74-9c25c1c588a9} - C:\Program Files (x86)\Java\jre6\bin\jp2ssv.dll
BHO: HP Smart BHO Class: {ffffffff-cf4e-4f2b-bdc2-0e72e116a856} - C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\hpswp_BHO.dll
TB: Bing Bar: {8dcb7100-df86-4384-8842-8fa844297b3f} - "C:\Program Files (x86)\Microsoft\BingBar\BingExt.dll"
TB: Searchqu Toolbar: {99079a25-328f-4bd4-be04-00955acaa0a7} - C:\PROGRA~2\WI3C8A~1\Datamngr\ToolBar\searchqudtx.dll
TB: Babylon Toolbar: {98889811-442d-49dd-99d7-dc866be87dbc} - C:\Program Files (x86)\BabylonToolbar\BabylonToolbar\\BabylonToolbarTlbr.dll
EB: HP Smart Web Printing: {555d4d79-4bd2-4094-a395-cfc534424a05} - C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\hpswp_bho.dll
uRun: [MsnMsgr] "C:\Program Files (x86)\Windows Live\Messenger\MsnMsgr.Exe" /background
uRun: [RGSC] C:\Program Files (x86)\Rockstar Games\Rockstar Games Social Club\RGSCLauncher.exe /silent
uRun: [EA Core] "C:\Program Files (x86)\Electronic Arts\EADM\Core.exe" -silent
uRun: [DAEMON Tools Pro Agent] "C:\Program Files (x86)\DAEMON Tools Pro\DTAgent.exe" -autorun
uRun: [Startw3i] C:\Program Files (x86)\PC Speed Maximizer\Startw3i.exe
uRun: [Logitech Vid] "C:\Program Files (x86)\Logitech\Vid HD\Vid.exe" -bootmode
uRun: [Google Update] "C:\Users\Dun\AppData\Local\Google\Update\GoogleUpdate.exe" /c
uRun: [Steam] "C:\Program Files (x86)\Steam\steam.exe" -silent
uRun: [Skype] "C:\Program Files (x86)\Skype\Phone\Skype.exe" /nosplash /minimized
mRun: [StartCCC] "C:\Program Files (x86)\ATI Technologies\ATI.ACE\Core-Static\CLIStart.exe" MSRun
mRun: [IAStorIcon] C:\Program Files (x86)\Intel\Intel(R) Rapid Storage Technology\IAStorIcon.exe
mRun: [Dell DataSafe Online] "C:\Program Files (x86)\Dell DataSafe Online\DataSafeOnline.exe" /m
mRun: [THX Audio Control Panel] "C:\Program Files (x86)\Creative\THX TruStudio PC\THXAudioCP\THXAudio.exe" /r
mRun: [UpdReg] C:\Windows\UpdReg.EXE
mRun: [mcui_exe] "C:\Program Files\McAfee.com\Agent\mcagent.exe" /runkey
mRun: [RemoteControl9] "c:\Program Files (x86)\CyberLink\PowerDVD9\PDVD9Serv.exe"
mRun: [PDVD9LanguageShortcut] "c:\Program Files (x86)\CyberLink\PowerDVD9\Language\Language.exe"
mRun: [BDRegion] c:\Program Files (x86)\Cyberlink\Shared Files\brs.exe
mRun: [DellSupportCenter] "C:\Program Files (x86)\Dell Support Center\bin\sprtcmd.exe" /P DellSupportCenter
mRun: [Adobe Reader Speed Launcher] "C:\Program Files (x86)\Adobe\Reader 9.0\Reader\Reader_sl.exe"
mRun: [Adobe ARM] "C:\Program Files (x86)\Common Files\Adobe\ARM\1.0\AdobeARM.exe"
mRun: [ATICustomerCare] "C:\Program Files (x86)\ATI\ATICustomerCare\ATICustomerCare.exe"
mRun: [HP Software Update] C:\Program Files (x86)\HP\HP Software Update\HPWuSchd2.exe
mRun: [LWS] C:\Program Files (x86)\Logitech\LWS\Webcam Software\LWS.exe -hide
mRun: [SunJavaUpdateSched] "C:\Program Files (x86)\Common Files\Java\Java Update\jusched.exe"
mRun: [AdobeCS5ServiceManager] "C:\Program Files (x86)\Common Files\Adobe\CS5ServiceManager\CS5ServiceManager.exe" -launchedbylogin
mRun: [SwitchBoard] C:\Program Files (x86)\Common Files\Adobe\SwitchBoard\SwitchBoard.exe
mRunOnce: ["C:\Program Files (x86)\Dell DataSafe Local Backup\Components\DSUpdate\DSUpdate.exe"] "C:\Program Files (x86)\Dell DataSafe Local Backup\Components\DSUpdate\DSUpdate.exe"
mRunOnce: [Launcher] C:\Program Files (x86)\Dell DataSafe Local Backup\Components\Scheduler\Launcher.exe
StartupFolder: C:\Users\Dun\AppData\Roaming\MICROS~1\Windows\STARTM~1\Programs\Startup\LOGITE~1.LNK - C:\Program Files (x86)\Logitech\Ereg\eReg.exe
StartupFolder: C:\PROGRA~3\MICROS~1\Windows\STARTM~1\Programs\Startup\HPDIGI~1.LNK - C:\Program Files (x86)\HP\Digital Imaging\bin\hpqtra08.exe
StartupFolder: C:\PROGRA~3\MICROS~1\Windows\STARTM~1\Programs\Startup\MCAFEE~1.LNK - C:\Program Files (x86)\McAfee Security Scan\2.0.181\SSScheduler.exe
mPolicies-explorer: NoActiveDesktop = 1 (0x1)
mPolicies-explorer: NoActiveDesktopChanges = 1 (0x1)
mPolicies-system: ConsentPromptBehaviorAdmin = 5 (0x5)
mPolicies-system: ConsentPromptBehaviorUser = 3 (0x3)
mPolicies-system: EnableUIADesktopToggle = 0 (0x0)
IE: &Enviar a OneNote - C:\PROGRA~1\MICROS~2\Office14\ONBttnIE.dll/105
IE: Download all by FlashGet3 - C:\Users\Dun\AppData\Roaming\FlashGetBHO\GetAllUrl.htm
IE: Download by FlashGet3 - C:\Users\Dun\AppData\Roaming\FlashGetBHO\GetUrl.htm
IE: E&xportar a Microsoft Excel - C:\PROGRA~1\MICROS~2\Office14\EXCEL.EXE/3000
IE: ????3?? - C:\Users\Dun\AppData\Roaming\FlashGetBHO\GetUrl.htm
IE: ????3?????? - C:\Users\Dun\AppData\Roaming\FlashGetBHO\GetAllUrl.htm
IE: {0000036B-C524-4050-81A0-243669A86B9F} - {B63DBA5F-523F-4B9C-A43D-65DF1977EAD3} - C:\Program Files (x86)\Windows Live\Companion\companioncore.dll
IE: {219C3416-8CB2-491a-A3C7-D9FCDDC9D600} - {5F7B1267-94A9-47F5-98DB-E99415F33AEC} - C:\Program Files (x86)\Windows Live\Writer\WriterBrowserExtension.dll
IE: {2670000A-7350-4f3c-8081-5663EE0C6C49} - {48E73304-E1D6-4330-914C-F5F514E3486C} - C:\Program Files (x86)\Microsoft Office\Office14\ONBttnIE.dll
IE: {789FE86F-6FC4-46A1-9849-EDE0DB0C95CA} - {FFFDC614-B694-4AE6-AB38-5D6374584B52} - C:\Program Files (x86)\Microsoft Office\Office14\ONBttnIELinkedNotes.dll
IE: {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - C:\Program Files (x86)\Skype\Toolbars\Internet Explorer\skypeieplugin.dll
IE: {DDE87865-83C5-48c4-8357-2F5B1AA84522} - {DDE87865-83C5-48c4-8357-2F5B1AA84522} - C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\hpswp_BHO.dll
Trusted Zone: kuaiche.com\software
DPF: {8AD9C840-044E-11D1-B3E9-00805F499D93} - hxxp://java.sun.com/update/1.6.0/jinsta ... s-i586.cab
DPF: {CAFEEFAC-0016-0000-0026-ABCDEFFEDCBA} - hxxp://java.sun.com/update/1.6.0/jinsta ... s-i586.cab
DPF: {CAFEEFAC-FFFF-FFFF-FFFF-ABCDEFFEDCBA} - hxxp://java.sun.com/update/1.6.0/jinsta ... s-i586.cab
DPF: {D27CDB6E-AE6D-11CF-96B8-444553540000} - hxxp://fpdownload2.macromedia.com/get/s ... wflash.cab
TCP: DhcpNameServer =
TCP: Interfaces\{24C3F84F-6C3B-4168-98D5-5B7C0DA87989} : DhcpNameServer =
Filter: text/xml - {807573E5-5146-11D5-A672-00B0D022E945} - C:\Program Files (x86)\Common Files\microsoft shared\OFFICE14\MSOXMLMF.DLL
Handler: skype-ie-addon-data - {91774881-D725-4E58-B298-07617B9B86A8} - C:\Program Files (x86)\Skype\Toolbars\Internet Explorer\skypeieplugin.dll
Handler: wlpg - {E43EF6CD-A37A-4A9B-9E6F-83F89B8E6324} - C:\Program Files (x86)\Windows Live\Photo Gallery\AlbumDownloadProtocolHandler.dll
AppInit_DLLs: C:\PROGRA~2\WI3C8A~1\Datamngr\datamngr.dll C:\PROGRA~2\WI3C8A~1\Datamngr\IEBHO.dll
SEH: Groove GFS Stub Execution Hook: {b5a7f190-dda6-4420-b3ba-52453494e6cd} - C:\PROGRA~2\MIF5BA~1\Office14\GROOVEEX.DLL
EB-X64: {555D4D79-4BD2-4094-A395-CFC534424A05} - No File
mRun-x64: [StartCCC] "C:\Program Files (x86)\ATI Technologies\ATI.ACE\Core-Static\CLIStart.exe" MSRun
mRun-x64: [IAStorIcon] C:\Program Files (x86)\Intel\Intel(R) Rapid Storage Technology\IAStorIcon.exe
mRun-x64: [Dell DataSafe Online] "C:\Program Files (x86)\Dell DataSafe Online\DataSafeOnline.exe" /m
mRun-x64: [THX Audio Control Panel] "C:\Program Files (x86)\Creative\THX TruStudio PC\THXAudioCP\THXAudio.exe" /r
mRun-x64: [UpdReg] C:\Windows\UpdReg.EXE
mRun-x64: [mcui_exe] "C:\Program Files\McAfee.com\Agent\mcagent.exe" /runkey
mRun-x64: [RemoteControl9] "c:\Program Files (x86)\CyberLink\PowerDVD9\PDVD9Serv.exe"
mRun-x64: [PDVD9LanguageShortcut] "c:\Program Files (x86)\CyberLink\PowerDVD9\Language\Language.exe"
mRun-x64: [BDRegion] c:\Program Files (x86)\Cyberlink\Shared Files\brs.exe
mRun-x64: [DellSupportCenter] "C:\Program Files (x86)\Dell Support Center\bin\sprtcmd.exe" /P DellSupportCenter
mRun-x64: [Adobe Reader Speed Launcher] "C:\Program Files (x86)\Adobe\Reader 9.0\Reader\Reader_sl.exe"
mRun-x64: [Adobe ARM] "C:\Program Files (x86)\Common Files\Adobe\ARM\1.0\AdobeARM.exe"
mRun-x64: [ATICustomerCare] "C:\Program Files (x86)\ATI\ATICustomerCare\ATICustomerCare.exe"
mRun-x64: [HP Software Update] C:\Program Files (x86)\HP\HP Software Update\HPWuSchd2.exe
mRun-x64: [LWS] C:\Program Files (x86)\Logitech\LWS\Webcam Software\LWS.exe -hide
mRun-x64: [SunJavaUpdateSched] "C:\Program Files (x86)\Common Files\Java\Java Update\jusched.exe"
mRun-x64: [DATAMNGR] C:\PROGRA~2\WI3C8A~1\Datamngr\DATAMN~1.EXE
mRun-x64: [AdobeCS5ServiceManager] "C:\Program Files (x86)\Common Files\Adobe\CS5ServiceManager\CS5ServiceManager.exe" -launchedbylogin
mRun-x64: [SwitchBoard] C:\Program Files (x86)\Common Files\Adobe\SwitchBoard\SwitchBoard.exe
mRunOnce-x64: ["C:\Program Files (x86)\Dell DataSafe Local Backup\Components\DSUpdate\DSUpdate.exe"] "C:\Program Files (x86)\Dell DataSafe Local Backup\Components\DSUpdate\DSUpdate.exe"
mRunOnce-x64: [Launcher] C:\Program Files (x86)\Dell DataSafe Local Backup\Components\Scheduler\Launcher.exe
AppInit_DLLs-X64: C:\PROGRA~2\WI3C8A~1\Datamngr\datamngr.dll C:\PROGRA~2\WI3C8A~1\Datamngr\IEBHO.dll
SEH-X64: {B5A7F190-DDA6-4420-B3BA-52453494E6CD}: Groove GFS Stub Execution Hook
================= FIREFOX ===================
FF - ProfilePath - C:\Users\Dun\AppData\Roaming\Mozilla\Firefox\Profiles\x4h0072c.default\
FF - prefs.js: browser.search.selectedEngine - Search Results
FF - prefs.js: browser.startup.homepage - hxxp://www.searchqu.com/406
FF - prefs.js: keyword.URL - hxxp://search.babylon.com/?babsrc=SP_ss ... =100377&q=
FF - prefs.js: network.proxy.type - 0
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpClipBook.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpClipBookDB.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpNeoLogger.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpSaturn.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpSeymour.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpSmartSelect.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpSmartWebPrinting.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpSWPOperation.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpXPLogging.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpXPMTC.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpXPMTL.dll
FF - component: C:\Program Files (x86)\HP\Digital Imaging\Smart Web Printing\MozillaAddOn3\components\hpXREStub.dll
FF - component: C:\Program Files (x86)\Mozilla Firefox\extensions\{AB2CE124-6272-4b12-94A9-7303C7397BD1}\components\SkypeFfComponent.dll
FF - component: C:\Users\Dun\AppData\Roaming\Mozilla\Firefox\Profiles\x4h0072c.default\extensions\{DB9127A2-3381-41ec-82B3-1B6ED4C6F29A}\components\FlashgetXpi.dll
FF - plugin: C:\PROGRA~2\MIF5BA~1\Office14\NPAUTHZ.DLL
FF - plugin: C:\PROGRA~2\MIF5BA~1\Office14\NPSPWRAP.DLL
FF - plugin: C:\Program Files (x86)\Java\jre6\bin\new_plugin\npdeployJava1.dll
FF - plugin: c:\Program Files (x86)\Microsoft Silverlight\4.0.60531.0\npctrlui.dll
FF - plugin: C:\Program Files (x86)\Mozilla Firefox\plugins\npdeployJava1.dll
FF - plugin: C:\Program Files (x86)\Mozilla Firefox\plugins\npijjiautoinstallpluginff.dll
FF - plugin: C:\Program Files (x86)\Pando Networks\Media Booster\npPandoWebPlugin.dll
FF - plugin: C:\Program Files (x86)\Windows Live\Photo Gallery\NPWLPG.dll
FF - plugin: C:\Users\Dun\AppData\Local\Google\Update\\npGoogleOneClick8.dll
FF - plugin: C:\Windows\SysWOW64\Macromed\Flash\NPSWF32.dll
============= SERVICES / DRIVERS ===============
R0 mfehidk;McAfee Inc. mfehidk;C:\Windows\system32\drivers\mfehidk.sys --> C:\Windows\system32\drivers\mfehidk.sys [?]
R0 mfewfpk;McAfee Inc. mfewfpk;C:\Windows\system32\drivers\mfewfpk.sys --> C:\Windows\system32\drivers\mfewfpk.sys [?]
R0 PxHlpa64;PxHlpa64;C:\Windows\system32\Drivers\PxHlpa64.sys --> C:\Windows\system32\Drivers\PxHlpa64.sys [?]
R1 mfenlfk;McAfee NDIS Light Filter;C:\Windows\system32\DRIVERS\mfenlfk.sys --> C:\Windows\system32\DRIVERS\mfenlfk.sys [?]
R1 vwififlt;Virtual WiFi Filter Driver;C:\Windows\system32\DRIVERS\vwififlt.sys --> C:\Windows\system32\DRIVERS\vwififlt.sys [?]
R2 AMD External Events Utility;AMD External Events Utility;C:\Windows\system32\atiesrxx.exe --> C:\Windows\system32\atiesrxx.exe [?]
R2 DockLoginService;Dock Login Service;C:\Program Files\Dell\DellDock\DockLogin.exe [2009-6-9 155648]
R2 HiPatchService;Hi-Rez Studios Authenticate and Update Service;C:\Program Files (x86)\Hi-Rez Studios\HiPatchService.exe [2011-2-25 23680]
R2 IAStorDataMgrSvc;Intel(R) Rapid Storage Technology;C:\Program Files (x86)\Intel\Intel(R) Rapid Storage Technology\IAStorDataMgrSvc.exe [2010-10-26 13336]
R2 LVPrcS64;Process Monitor;C:\Program Files\Common Files\Logishrd\LVMVFM\LVPrcSrv.exe [2010-5-7 197976]
R2 McMPFSvc;McAfee Servicio Personal Firewall;C:\Program Files\Common Files\mcafee\mcsvchost\McSvHost.exe [2010-11-21 355440]
R2 McNaiAnn;McAfee VirusScan Announcer;C:\Program Files\Common Files\mcafee\mcsvchost\McSvHost.exe [2010-11-21 355440]
R2 McProxy;McAfee Proxy Service;C:\Program Files\Common Files\mcafee\mcsvchost\McSvHost.exe [2010-11-21 355440]
R2 McShield;McShield;C:\Program Files\Common Files\mcafee\systemcore\mcshield.exe [2010-10-26 200056]
R2 mfefire;McAfee Firewall Core Service;C:\Program Files\Common Files\mcafee\systemcore\mfefire.exe [2010-10-26 245352]
R2 mfevtp;McAfee Validation Trust Protection Service;C:\Program Files\Common Files\mcafee\systemcore\mfevtps.exe [2010-10-26 149032]
R2 SftService;SoftThinks Agent Service;C:\Program Files (x86)\Dell DataSafe Local Backup\SftService.exe [2010-10-26 705856]
R2 UMVPFSrv;UMVPFSrv;C:\Program Files (x86)\Common Files\LogiShrd\LVMVFM\UMVPFSrv.exe [2011-4-1 428640]
R3 amdkmdag;amdkmdag;C:\Windows\system32\DRIVERS\atikmdag.sys --> C:\Windows\system32\DRIVERS\atikmdag.sys [?]
R3 amdkmdap;amdkmdap;C:\Windows\system32\DRIVERS\atikmpag.sys --> C:\Windows\system32\DRIVERS\atikmpag.sys [?]
R3 AtiHDAudioService;ATI Function Driver for HD Audio Service;C:\Windows\system32\drivers\AtihdW76.sys --> C:\Windows\system32\drivers\AtihdW76.sys [?]
R3 cfwids;McAfee Inc. cfwids;C:\Windows\system32\drivers\cfwids.sys --> C:\Windows\system32\drivers\cfwids.sys [?]
R3 LVPr2M64;Logitech LVPr2M64 Driver;C:\Windows\system32\DRIVERS\LVPr2M64.sys --> C:\Windows\system32\DRIVERS\LVPr2M64.sys [?]
R3 mfeavfk;McAfee Inc. mfeavfk;C:\Windows\system32\drivers\mfeavfk.sys --> C:\Windows\system32\drivers\mfeavfk.sys [?]
R3 mfefirek;McAfee Inc. mfefirek;C:\Windows\system32\drivers\mfefirek.sys --> C:\Windows\system32\drivers\mfefirek.sys [?]
R3 PCDSRVC{1E208CE0-FB7451FF-06020101}_0;PCDSRVC{1E208CE0-FB7451FF-06020101}_0 - PCDR Kernel Mode Service Helper Driver;C:\Program Files\Dell Support Center\pcdsrvc_x64.pkms [2011-5-12 25072]
R3 RSUSBSTOR;RtsUStor.Sys Realtek USB Card Reader;C:\Windows\system32\Drivers\RtsUStor.sys --> C:\Windows\system32\Drivers\RtsUStor.sys [?]
R3 RTL8167;Realtek 8167 NT Driver;C:\Windows\system32\DRIVERS\Rt64win7.sys --> C:\Windows\system32\DRIVERS\Rt64win7.sys [?]
S2 CLKMSVC10_9EC60124;CyberLink Product - 2010/10/26 19:18:03;C:\Program Files (x86)\CyberLink\PowerDVD9\NavFilter\kmsvc.exe [2010-4-26 232944]
S2 clr_optimization_v4.0.30319_32;Microsoft .NET Framework NGEN v4.0.30319_X86;C:\Windows\Microsoft.NET\Framework\v4.0.30319\mscorsvw.exe [2010-3-18 130384]
S2 clr_optimization_v4.0.30319_64;Microsoft .NET Framework NGEN v4.0.30319_X64;C:\Windows\Microsoft.NET\Framework64\v4.0.30319\mscorsvw.exe [2010-3-18 138576]
S2 SessionLauncher;SessionLauncher;c:\Users\ADMINI~1\AppData\Local\Temp\DX9\SessionLauncher.exe --> c:\Users\ADMINI~1\AppData\Local\Temp\DX9\SessionLauncher.exe [?]
S3 BBSvc;Bing Bar Update Service;C:\Program Files (x86)\Microsoft\BingBar\BBSvc.EXE [2011-2-28 183560]
S3 fssfltr;fssfltr;C:\Windows\system32\DRIVERS\fssfltr.sys --> C:\Windows\system32\DRIVERS\fssfltr.sys [?]
S3 fsssvc;Windows Live Family Safety Service;C:\Program Files (x86)\Windows Live\Family Safety\fsssvc.exe [2010-9-23 1493352]
S3 LVRS64;Logitech RightSound Filter Driver;C:\Windows\system32\DRIVERS\lvrs64.sys --> C:\Windows\system32\DRIVERS\lvrs64.sys [?]
S3 LVUVC64;Logitech Webcam Pro 9000(UVC);C:\Windows\system32\DRIVERS\lvuvc64.sys --> C:\Windows\system32\DRIVERS\lvuvc64.sys [?]
S3 McComponentHostService;McAfee Security Scan Component Host Service;C:\Program Files (x86)\McAfee Security Scan\2.0.181\McCHSvc.exe [2010-1-15 227232]
S3 mferkdet;McAfee Inc. mferkdet;C:\Windows\system32\drivers\mferkdet.sys --> C:\Windows\system32\drivers\mferkdet.sys [?]
S3 Microsoft SharePoint Workspace Audit Service;Microsoft SharePoint Workspace Audit Service;C:\Program Files\Microsoft Office\Office14\GROOVE.EXE [2010-3-25 51456888]
S3 npggsvc;nProtect GameGuard Service;C:\Windows\system32\GameMon.des -service --> C:\Windows\system32\GameMon.des -service [?]
S3 ose64;Office 64 Source Engine;C:\Program Files\Common Files\Microsoft Shared\Source Engine\OSE.EXE [2010-1-9 174440]
S3 osppsvc;Office Software Protection Platform;C:\Program Files\Common Files\Microsoft Shared\OfficeSoftwareProtectionPlatform\OSPPSVC.EXE [2010-1-9 4925184]
S3 RoxMediaDB10;RoxMediaDB10;C:\Program Files (x86)\Common Files\Roxio Shared\10.0\SharedCom\RoxMediaDB10.exe [2009-6-26 1124848]
S3 SwitchBoard;SwitchBoard;C:\Program Files (x86)\Common Files\Adobe\SwitchBoard\SwitchBoard.exe [2010-2-19 517096]
S3 WatAdminSvc;Servicio de tecnologías de activación de Windows;C:\Windows\system32\Wat\WatAdminSvc.exe --> C:\Windows\system32\Wat\WatAdminSvc.exe [?]
S4 McOobeSv;McAfee OOBE Service;C:\Program Files\Common Files\mcafee\mcsvchost\McSvHost.exe [2010-11-21 355440]
S4 MSSQLServerADHelper100;Servicio auxiliar de SQL Active Directory;C:\Program Files\Microsoft SQL Server\100\Shared\sqladhlp.exe [2009-7-22 61976]
S4 RsFx0103;RsFx0103 Driver;C:\Windows\system32\DRIVERS\RsFx0103.sys --> C:\Windows\system32\DRIVERS\RsFx0103.sys [?]
S4 SQLAgent$SQLEXPRESS;Agente SQL Server (SQLEXPRESS);C:\Program Files\Microsoft SQL Server\MSSQL10.SQLEXPRESS\MSSQL\Binn\SQLAGENT.EXE [2009-3-30 427880]
S4 wlcrasvc;Windows Live Mesh remote connections service;C:\Program Files\Windows Live\Mesh\wlcrasvc.exe [2010-9-22 57184]
=============== Created Last 30 ================
2011-07-23 14:29:45 -------- d-----w- C:\Users\Dun\AppData\Local\{715A3C41-E687-471F-9724-81C480E40B63}
2011-07-22 22:44:11 -------- d-----w- C:\Users\Dun\AppData\Local\{C19757B4-22D8-4A56-B8F1-4B8AEBB9EBD8}
2011-07-22 15:59:01 8578896 ----a-w- C:\ProgramData\Microsoft\Windows Defender\Definition Updates\{D61940EF-29E2-4E53-BAE1-CA4A5E961E26}\mpengine.dll
2011-07-22 10:43:33 -------- d-----w- C:\Users\Dun\AppData\Local\{727D49A3-A95E-41BF-A4D7-2DB2BFFB8237}
2011-07-22 02:15:10 -------- d-----w- C:\Windows\_ISTMP1.DIR
2011-07-22 01:45:39 -------- d-----w- C:\PSPICE
2011-07-22 01:44:20 -------- d-----w- C:\Program Files (x86)\BabylonToolbar
2011-07-22 01:43:13 -------- d-----w- C:\Users\Dun\AppData\Local\Babylon
2011-07-22 01:43:13 -------- d-----w- C:\ProgramData\Babylon
2011-07-22 01:43:12 -------- d-----w- C:\Users\Dun\AppData\Roaming\Babylon
2011-07-21 16:20:16 -------- d-----w- C:\Users\Dun\AppData\Local\{8CBFBB2A-D316-4104-A376-A04F904A5A50}
2011-07-21 04:19:41 -------- d-----w- C:\Users\Dun\AppData\Local\{BAC54C23-D3D6-4F33-8637-6CCEBE9824F7}
2011-07-20 16:19:07 -------- d-----w- C:\Users\Dun\AppData\Local\{08C69DE6-3898-456D-AE44-624BEC1FE787}
2011-07-20 04:18:30 -------- d-----w- C:\Users\Dun\AppData\Local\{791DF2DD-2807-4004-AC99-CA6CDE291592}
2011-07-19 16:17:47 -------- d-----w- C:\Users\Dun\AppData\Local\{7F1A0547-70C1-4E3C-AD5C-967363E5F34B}
2011-07-18 17:44:03 -------- d-----w- C:\Users\Dun\AppData\Local\{A638BB74-12A8-49A9-BF8D-C6B2B5C47B5D}
2011-07-17 15:05:12 -------- d-----w- C:\Users\Dun\AppData\Local\{7B3CECF8-14CD-4000-98AA-ED2EDE72A910}
2011-07-16 16:02:12 -------- d-----w- C:\Users\Dun\AppData\Roaming\chc.4875E02D9FB21EE389F73B8D1702B320485DF8CE.1
2011-07-16 15:48:48 -------- d-----w- C:\ProgramData\regid.1986-12.com.adobe
2011-07-16 04:09:02 -------- d-----w- C:\Users\Dun\AppData\Local\{48072802-0B4B-474B-ABC9-A49E99ED2ABE}
2011-07-15 16:08:24 -------- d-----w- C:\Users\Dun\AppData\Local\{3791B02E-CE3B-4876-91FD-FBC4F5D15F95}
2011-07-14 14:58:34 -------- d-----w- C:\Users\Dun\AppData\Local\{AA427E78-C0BB-4775-B334-3553AFF98212}
2011-07-13 10:15:42 -------- d-----w- C:\Users\Dun\AppData\Local\{BE11A2A1-A982-41FC-A5B0-31A92EC10BA8}
2011-07-12 16:07:12 -------- d-----w- C:\Users\Dun\AppData\Local\{A3BE7964-3987-47B5-8189-EB4E37F42F8B}
2011-07-11 16:35:46 -------- d-----w- C:\Users\Dun\AppData\Local\{0EFEE532-197A-456D-A274-8DE9913FEA01}
2011-07-10 14:36:26 -------- d-----w- C:\Users\Dun\AppData\Local\{7B900EC6-5AE5-4201-8CD2-D4EB51DDA8CF}
2011-07-09 13:32:36 -------- d-----w- C:\Users\Dun\AppData\Local\{DC851C9C-8FA1-4E14-A41A-433ECE2442E1}
2011-07-08 17:59:38 -------- d-----w- C:\Users\Dun\AppData\Local\Geckofx
2011-07-08 17:59:31 -------- d-----w- C:\Users\Dun\AppData\Roaming\Firefly Studios
2011-07-08 16:23:52 -------- d-----w- C:\Users\Dun\AppData\Local\{AD7986B9-D685-40DB-A1C6-7FCDA91ECD56}
2011-07-08 01:55:37 -------- d-----w- C:\ProgramData\Firefly Studios
2011-07-08 01:54:12 -------- d-----w- C:\Program Files (x86)\Firefly Studios
2011-07-07 17:36:10 -------- d-----w- C:\Users\Dun\AppData\Local\{D0E34F4A-AEA8-4F40-8149-B7B3AC0260EA}
2011-07-06 15:00:07 -------- d-----w- C:\Users\Dun\AppData\Local\{FAA1B547-7323-4686-9613-A238E17066FA}
2011-07-06 02:52:09 -------- d-----w- C:\Users\Dun\AppData\Local\{B3AD21D3-19E8-4EBC-BA93-11BD8942E395}
2011-07-05 14:51:32 -------- d-----w- C:\Users\Dun\AppData\Local\{6BBD6523-64FA-4F42-B240-82B702C80718}
2011-07-05 02:50:57 -------- d-----w- C:\Users\Dun\AppData\Local\{9E00BF71-D9F4-4A17-81FC-77262ECAE046}
2011-07-04 14:35:56 -------- d-----w- C:\Users\Dun\AppData\Local\{9C1FE048-B597-4B9C-922B-914B2B9B017A}
2011-07-03 14:35:00 -------- d-----w- C:\Users\Dun\AppData\Local\{B76CA2A8-CB99-40F1-888A-425B860D0F93}
2011-07-03 02:34:26 -------- d-----w- C:\Users\Dun\AppData\Local\{DCEFD285-2805-4463-82F2-2FF5D62B3B76}
2011-07-02 15:34:25 -------- d-----w- C:\ProgramData\boost_interprocess
2011-07-02 15:34:25 -------- d-----w- C:\Program Files (x86)\Windows iLivid Toolbar
2011-07-02 15:33:24 -------- d-----w- C:\Users\Dun\AppData\Local\PackageAware
2011-07-02 14:33:51 -------- d-----w- C:\Users\Dun\AppData\Local\{FE0E698D-2C63-46A2-80FF-46EDF7BFDFCB}
2011-07-01 16:27:27 2106216 ----a-w- C:\Program Files (x86)\Mozilla Firefox\D3DCompiler_43.dll
2011-07-01 16:27:27 1998168 ----a-w- C:\Program Files (x86)\Mozilla Firefox\d3dx9_43.dll
2011-07-01 16:25:03 -------- d-----w- C:\Users\Dun\AppData\Local\{703D8DB4-AFA5-4EDF-A2DF-6A8B2B8FB86A}
2011-06-30 15:57:21 -------- d-----w- C:\Users\Dun\AppData\Local\{92D380CE-5D29-4355-8106-C6333ED44A2A}
2011-06-30 03:30:35 -------- d-----w- C:\Users\Dun\AppData\Local\{7C36AA41-6EA0-47F7-B03E-529D1078EF14}
2011-06-30 03:30:25 -------- d-----w- C:\Users\Dun\AppData\Local\{369CA9F3-0BA0-4E02-9A33-8EFD74E35160}
2011-06-29 16:12:02 64512 ----a-w- C:\Windows\SysWow64\devobj.dll
2011-06-29 16:12:02 44544 ----a-w- C:\Windows\SysWow64\devrtl.dll
2011-06-29 16:12:02 404992 ----a-w- C:\Windows\System32\umpnpmgr.dll
2011-06-29 16:12:02 252928 ----a-w- C:\Windows\SysWow64\drvinst.exe
2011-06-29 16:12:02 145920 ----a-w- C:\Windows\SysWow64\cfgmgr32.dll
2011-06-29 15:29:47 -------- d-----w- C:\Users\Dun\AppData\Local\{C3B5FBFB-0768-46FE-9EBD-926EAE01695B}
2011-06-29 00:32:29 -------- d-----w- C:\Users\Dun\AppData\Local\{72386A2B-E057-4112-95D8-8F27305ADD95}
2011-06-29 00:32:16 -------- d-----w- C:\Users\Dun\AppData\Local\{AE90544A-B723-48B8-87B3-3C48376156C8}
2011-06-28 12:31:38 -------- d-----w- C:\Users\Dun\AppData\Local\{10058292-E694-4D2E-BD5E-84C8D1EC1602}
2011-06-27 17:55:21 -------- d-----w- C:\Users\Dun\AppData\Local\{E1F03457-2248-4C0B-814D-5DD8B411EA81}
2011-06-27 01:59:32 -------- d-----w- C:\Users\Dun\AppData\Local\{EE8651B9-2369-43F5-953B-864B38CD3AFB}
2011-06-26 13:58:49 -------- d-----w- C:\Users\Dun\AppData\Local\{CEA19E65-7A59-4063-8F2B-048269089CA5}
2011-06-26 01:40:07 -------- d-----w- C:\Users\Dun\AppData\Local\{C190820F-6547-452E-99BB-72AFC6844221}
2011-06-24 15:42:34 -------- d-----w- C:\Program Files (x86)\Common Files\Steam
2011-06-24 15:42:32 -------- d-----w- C:\Program Files (x86)\Steam
2011-06-24 15:00:16 -------- d-----w- C:\Users\Dun\AppData\Local\{5B337D45-E2C4-4282-9D0C-10FDB4B29524}
2011-06-24 02:47:03 -------- d-----w- C:\Users\Dun\AppData\Roaming\Youtube Downloader HD
2011-06-24 02:46:56 -------- d-----w- C:\Program Files (x86)\Youtube Downloader HD
==================== Find3M ====================
2011-06-27 13:30:43 404640 ----a-w- C:\Windows\SysWow64\FlashPlayerCPLApp.cpl
2011-06-11 02:56:44 3134464 ----a-w- C:\Windows\System32\win32k.sys
2011-06-02 06:45:22 362496 ----a-w- C:\Windows\System32\wow64win.dll
2011-06-02 06:45:22 243200 ----a-w- C:\Windows\System32\wow64.dll
2011-06-02 06:45:22 13312 ----a-w- C:\Windows\System32\wow64cpu.dll
2011-06-02 06:44:54 214528 ----a-w- C:\Windows\System32\winsrv.dll
2011-06-02 06:42:37 16384 ----a-w- C:\Windows\System32\ntvdm64.dll
2011-06-02 06:39:54 422400 ----a-w- C:\Windows\System32\KernelBase.dll
2011-06-02 06:35:56 338944 ----a-w- C:\Windows\System32\conhost.exe
2011-06-02 05:59:44 14336 ----a-w- C:\Windows\SysWow64\ntvdm64.dll
2011-06-02 05:56:28 44032 ----a-w- C:\Windows\apppatch\acwow64.dll
2011-06-02 05:56:06 25600 ----a-w- C:\Windows\SysWow64\setup16.exe
2011-06-02 05:54:51 5120 ----a-w- C:\Windows\SysWow64\wow32.dll
2011-06-02 05:54:50 272384 ----a-w- C:\Windows\SysWow64\KernelBase.dll
2011-06-02 03:51:00 7680 ----a-w- C:\Windows\SysWow64\instnm.exe
2011-06-02 03:50:59 2048 ----a-w- C:\Windows\SysWow64\user.exe
2011-06-02 03:45:49 6144 ---ha-w- C:\Windows\SysWow64\api-ms-win-security-base-l1-1-0.dll
2011-06-02 03:45:49 4608 ---ha-w- C:\Windows\SysWow64\api-ms-win-core-threadpool-l1-1-0.dll
2011-06-02 03:45:49 3584 ---ha-w- C:\Windows\SysWow64\api-ms-win-core-xstate-l1-1-0.dll
2011-06-02 03:45:49 3072 ---ha-w- C:\Windows\SysWow64\api-ms-win-core-util-l1-1-0.dll
2011-05-24 23:44:10 270720 ------w- C:\Windows\System32\MpSigStub.exe
2011-05-05 05:58:10 59904 ----a-w- C:\Windows\SysWow64\OVDecode.dll
2011-05-05 05:57:58 51712 ----a-w- C:\Windows\SysWow64\OpenCL.dll
2011-05-05 05:57:42 12385280 ----a-w- C:\Windows\SysWow64\amdocl.dll
2011-05-04 09:22:22 472808 ----a-w- C:\Windows\SysWow64\deployJava1.dll
2011-05-04 05:30:38 2326016 ----a-w- C:\Windows\System32\tquery.dll
2011-05-04 05:28:07 779264 ----a-w- C:\Windows\System32\mssvp.dll
2011-05-04 05:28:07 2228224 ----a-w- C:\Windows\System32\mssrch.dll
2011-05-04 05:28:06 75264 ----a-w- C:\Windows\System32\msscntrs.dll
2011-05-04 05:28:06 491520 ----a-w- C:\Windows\System32\mssph.dll
2011-05-04 05:28:06 288256 ----a-w- C:\Windows\System32\mssphtb.dll
2011-05-04 05:24:09 593408 ----a-w- C:\Windows\System32\SearchIndexer.exe
2011-05-04 05:24:09 249856 ----a-w- C:\Windows\System32\SearchProtocolHost.exe
2011-05-04 05:24:09 113664 ----a-w- C:\Windows\System32\SearchFilterHost.exe
2011-05-04 04:53:10 1553920 ----a-w- C:\Windows\SysWow64\tquery.dll
2011-05-04 04:52:59 666624 ----a-w- C:\Windows\SysWow64\mssvp.dll
2011-05-04 04:52:59 59392 ----a-w- C:\Windows\SysWow64\msscntrs.dll
2011-05-04 04:52:59 337408 ----a-w- C:\Windows\SysWow64\mssph.dll
2011-05-04 04:52:59 197120 ----a-w- C:\Windows\SysWow64\mssphtb.dll
2011-05-04 04:52:59 1401856 ----a-w- C:\Windows\SysWow64\mssrch.dll
2011-05-04 04:52:12 86528 ----a-w- C:\Windows\SysWow64\SearchFilterHost.exe
2011-05-04 04:52:12 428032 ----a-w- C:\Windows\SysWow64\SearchIndexer.exe
2011-05-04 04:52:12 164352 ----a-w- C:\Windows\SysWow64\SearchProtocolHost.exe
2011-05-04 02:51:08 287744 ----a-w- C:\Windows\System32\drivers\mrxsmb10.sys
2011-05-04 02:51:08 157696 ----a-w- C:\Windows\System32\drivers\mrxsmb.sys
2011-05-04 02:51:05 126464 ----a-w- C:\Windows\System32\drivers\mrxsmb20.sys
2011-05-03 05:21:22 976896 ----a-w- C:\Windows\System32\inetcomm.dll
2011-05-03 04:50:29 740864 ----a-w- C:\Windows\SysWow64\inetcomm.dll
2011-04-29 03:13:10 461312 ----a-w- C:\Windows\System32\drivers\srv.sys
2011-04-29 03:12:54 399872 ----a-w- C:\Windows\System32\drivers\srv2.sys
2011-04-29 03:12:37 161792 ----a-w- C:\Windows\System32\drivers\srvnet.sys
2011-04-27 02:57:40 102400 ----a-w- C:\Windows\System32\drivers\dfsc.sys
2011-04-25 05:32:22 1896832 ----a-w- C:\Windows\System32\drivers\tcpip.sys
2011-04-25 02:44:02 499712 ----a-w- C:\Windows\System32\drivers\afd.sys
============= FINISH: 21:19:57,01 ===============

DDS (Ver_2011-06-23.01)
Microsoft Windows 7 Home Premium
Boot Device: \Device\HarddiskVolume2
Install Date: 19/11/2010 08:41:42 a.m.
System Uptime: 23/07/2011 09:58:33 a.m. (12 hours ago)
Motherboard: Dell Inc. | | 05DN3X
Processor: Intel(R) Core(TM) i7 CPU 930 @ 2.80GHz | CPU 1 | 2801/133mhz
==== Disk Partitions =========================
C: is FIXED (NTFS) - 922 GiB total, 695,235 GiB free.
D: is CDROM ()
E: is Removable
F: is CDROM ()
==== Disabled Device Manager Items =============
==== System Restore Points ===================
RP171: 13/07/2011 06:52:15 a.m. - Windows Update
RP172: 15/07/2011 12:02:58 p.m. - Windows Update
RP173: 19/07/2011 11:56:09 a.m. - Windows Update
RP174: 22/07/2011 11:28:32 a.m. - Windows Update
==== Installed Programs ======================
Adobe AIR
Adobe Community Help
Adobe Flash Player 10 ActiveX
Adobe Flash Player 10 Plugin
Adobe Flash Professional CS5
Adobe Media Player
Adobe Photoshop CS4
Adobe Reader 9.4.4 - Español
Adobe Shockwave Player 11.5
Age of Conan - Hyborian Adventures
Allods Online
ATI Catalyst Registration
Babylon toolbar on IE
Battlefield Play4Free
Bing Bar
Catalyst Control Center
Catalyst Control Center - Branding
Catalyst Control Center Graphics Previews Common
Catalyst Control Center Graphics Previews Vista
Catalyst Control Center InstallProxy
CCC Help English
Control ActiveX de Windows Live Mesh para conexiones remotas
CyberLink PowerDVD 9.5
Dell DataSafe Local Backup
Dell DataSafe Local Backup - Support Software
Dell DataSafe Online
Dell Dock
Dell Getting Started Guide
EA Download Manager
EMC 10 Content
FlashGet 3.3
Galería fotográfica de Windows Live
Global Agenda Launcher
Google Chrome
Grand Theft Auto IV
Hotfix for Microsoft Visual C++ 2010 Express - ESN (KB2542054)
HP Product Detection
HP Update
Install Creator
Intel(R) Control Center
Intel(R) Rapid Storage Technology
Java Auto Updater
Java(TM) 6 Update 26
Junk Mail filter update
Logitech Vid HD
Los Sims™ 3
LTspice IV
LWS Facebook
LWS Gallery
LWS Help_main
LWS Launcher
LWS Motion Detection
LWS Pictures And Video
LWS Video Mask Maker
LWS Webcam Software
LWS WLM Plugin
LWS YouTube Plugin
McAfee Security Center
McAfee Security Scan Plus
Medal of Honor (TM)
Mesh Runtime
Messenger Companion
Microsoft .NET Framework 1.1
Microsoft .NET Framework 4 Multi-Targeting Pack
Microsoft Application Error Reporting
Microsoft Games for Windows - LIVE Redistributable
Microsoft Games for Windows Marketplace
Microsoft Silverlight
Microsoft SQL Server 2005 Compact Edition [ENU]
Microsoft SQL Server 2008 Browser
Microsoft SQL Server Compact 3.5 SP2 ESN
Microsoft Visual C++ 2005 Redistributable
Microsoft Visual C++ 2008 ATL Update kb973924 - x86 9.0.30729.4148
Microsoft Visual C++ 2008 Redistributable - KB2467174 - x86 9.0.30729.5570
Microsoft Visual C++ 2008 Redistributable - x86 9.0.21022
Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729
Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.17
Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.4974
Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.6161
Microsoft Visual C++ 2010 Express - ESN
Microsoft WSE 3.0 Runtime
Mozilla Firefox 5.0 (x86 es-ES)
MSXML 4.0 SP2 (KB954430)
MSXML 4.0 SP2 (KB973688)
Need for Speed™ SHIFT
Norton Security Scan
OGA Notifier 2.0.0048.0
Pando Media Booster
PDF Settings CS5
Priston Tale 2 (English)
PSpice Student 9.1
PunkBuster Services
Realtek High Definition Audio Driver
Regnum Online 1.6.2
RenderMonkey 1.82
Rockstar Games Social Club
Roxio Activation Module
Roxio BackOnTrack
Roxio Central Audio
Roxio Central Copy
Roxio Central Core
Roxio Central Data
Roxio Central Tools
Roxio Easy CD and DVD Burning
Roxio Express Labeler 3
Roxio Update Manager
Runes of Magic
Security Update for CAPICOM (KB931906)
Security Update for Microsoft .NET Framework 4 Client Profile (KB2160841)
Security Update for Microsoft .NET Framework 4 Client Profile (KB2446708)
Security Update for Microsoft .NET Framework 4 Client Profile (KB2478663)
Security Update for Microsoft .NET Framework 4 Client Profile (KB2518870)
Security Update for Microsoft .NET Framework 4 Extended (KB2416472)
Security Update for Microsoft Visual C++ 2010 Express - ESN (KB2251489)
Security Update for Paquete de idioma de Microsoft .NET Framework 4 Client Profile ESN (KB2478663)
Security Update for Paquete de idioma de Microsoft .NET Framework 4 Client Profile ESN (KB2518870)
Shader Designer
Skype Toolbars
Skype™ 5.3
Software de cámara Web Logitech
Sonic CinePlayer Decoder Pack
Stronghold Kingdoms
Team Fortress 2
TeXaide 4
The Lord of the Rings FREE Trial
The Lord of the Rings Online™ v03.02.04.8007
The Witcher Enhanced Edition
THX TruStudio PC
Trusted Software Assistant
Update for Microsoft .NET Framework 4 Client Profile (KB2473228)
WinDjview 0.5
Windows iLivid Toolbar
Windows Live Communications Platform
Windows Live Essentials
Windows Live Installer
Windows Live Mail
Windows Live Mesh
Windows Live Messenger
Windows Live Messenger Companion Core
Windows Live Movie Maker
Windows Live Photo Common
Windows Live Photo Gallery
Windows Live PIMT Platform
Windows Live SOXE
Windows Live SOXE Definitions
Windows Live UX Platform
Windows Live UX Platform Language Pack
Windows Live Writer
Windows Live Writer Resources
WinRAR archiver
Xfire (remove only)
Youtube Downloader HD v. 2.5
==== Event Viewer Messages From Past Week ========
23/07/2011 09:59:11 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: 490@01010004
23/07/2011 09:59:09 a.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
23/07/2011 09:58:55 a.m., Error: Service Control Manager [7000] - El servicio SessionLauncher no pudo iniciarse debido al siguiente error: El sistema no puede encontrar el archivo especificado.
23/07/2011 08:47:17 p.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: 490@01010004
22/07/2011 11:25:32 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: 490@01010004
22/07/2011 11:25:29 a.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
22/07/2011 06:13:00 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
22/07/2011 06:13:00 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
22/07/2011 06:13:00 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
22/07/2011 06:12:53 a.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
21/07/2011 11:29:09 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: 490@01010004
21/07/2011 11:29:08 a.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
21/07/2011 08:59:45 p.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
21/07/2011 08:59:45 p.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
21/07/2011 08:59:45 p.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
21/07/2011 08:59:41 p.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
20/07/2011 09:55:58 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
20/07/2011 09:55:58 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
20/07/2011 09:55:58 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
20/07/2011 09:55:53 a.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
20/07/2011 06:10:31 p.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: 490@01010004
20/07/2011 06:10:30 p.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
19/07/2011 11:46:48 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
19/07/2011 11:46:48 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
19/07/2011 11:46:48 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: D@01010004
19/07/2011 11:46:45 a.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
19/07/2011 06:30:48 p.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: 490@01010004
19/07/2011 06:30:45 p.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
18/07/2011 01:13:22 p.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: 490@01010004
18/07/2011 01:13:18 p.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
17/07/2011 10:34:35 a.m., Error: VDS Basic Provider [1] - Error inesperado. Código de error: 490@01010004
17/07/2011 10:34:34 a.m., Error: Service Control Manager [7026] - El siguiente controlador de inicio del sistema o de inicio del arranque no se cargó correctamente: RxFilter
==== End Of File ===========================
Active Member
Posts: 3
Joined: July 23rd, 2011, 9:52 pm
Register to Remove

Re: searchqu as main page and explorer doesnt work

Unread postby deltalima » July 24th, 2011, 3:44 pm

Hi Doomviolence,

Please let me know if this computer is used for business purposes.
User avatar
Posts: 7614
Joined: February 28th, 2009, 4:38 pm
Location: UK

Re: searchqu as main page and explorer doesnt work

Unread postby Doomviolence » July 24th, 2011, 5:00 pm

no, it is not used for business purposes.
Active Member
Posts: 3
Joined: July 23rd, 2011, 9:52 pm

Re: searchqu as main page and explorer doesnt work

Unread postby deltalima » July 24th, 2011, 5:12 pm

Hi Doomviolence,

Welcome to the forum.

Please be aware that removing Malware is a potentially hazardous undertaking. I will take care not to knowingly suggest courses of action that might damage your computer. However it is impossible for me to foresee all interactions that may happen between the software on your computer and those we'll use to clear you of infection, and I cannot guarantee the safety of your system. It is possible that we might encounter situations where the only recourse is to re-format and re-install your operating system, or to necessitate you taking your computer to a repair shop.

Please note the following:
  • I will be working on your Malware issues, this may or may not, solve other issues you have with your machine.
  • The fixes are specific to your problem and should only be used for this issue on this machine.
  • Please do not run any scans or make any changes to the system unless I ask you too.
  • Please continue to review my answers until I tell you your machine appears to be clear. Absence of symptoms does not mean that everything is clear.
  • If after 3 days you have not responded to this topic, it will be closed, and you will need to start a new one.
  • It's often worth reading through these instructions and printing them for ease of reference.
  • If you don't know or understand something, please don't hesitate to say or ask!! It's better to be sure and safe than sorry.
  • Please reply to this thread. Do not start a new topic.

Please Note:
The programs I ask you to run need to be run in Administrator Mode by... Right clicking the program file and selecting: Run as Administrator.
Additionally, the built-in User Account Control (UAC) utility, if enabled, may prompt you for permission to run the program.
When prompted, please select: Allow. Reference: User Account Control (UAC) and Running as Administrator


  • Please download CKScanner from here to your Desktop.
  • Make sure that CKScanner.exe is on the your Desktop before running the application!
  • Right click on CKScanner.exe and select: Run as Administrator then click Search For Files.
  • After a very short time, when the cursor hourglass disappears, click Save List To File.
  • A message box will verify the file saved
  • Double-click on the CKFiles.txt icon on your Desktop and copy/paste the contents in your next reply.


  • Please download this tool from Microsoft.
  • Right click on MGADiag.exe and select: Run as Administrator
  • Click Continue.
  • The program will run. It takes a while to finish the diagnosis, please be patient.
  • Once done, click on Copy.
  • Open Notepad and paste the contents in the window.
  • Save this file and copy/paste it in your next reply.
User avatar
Posts: 7614
Joined: February 28th, 2009, 4:38 pm
Location: UK

Re: searchqu as main page and explorer doesnt work

Unread postby Doomviolence » July 24th, 2011, 5:39 pm


CKScanner - Additional Security Risks - These are not necessarily bad
c:\program files (x86)\amd\rendermonkey 1.82\examples\media\models\crackedquad.3ds
c:\program files (x86)\gimp\share\gimp\2.0\patterns\cracked.pat
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrack.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmaplightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmaplightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmappointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackenvmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcracklightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcracklightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmaplightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmaplightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmappointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetailcrackshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrack.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcracklightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_218318_4\rashaderstmbasedetaildirtcrackshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_222577_4\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\dun\documents\battlefield play4free\mods\main\cache\{d7b71ee2-2bf8-11cf-ae77-4905bec2c535}_223032_4\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
hosts activate.adobe.com
hosts activate-sea.adobe.com
hosts activate-sjc0.adobe.com
hosts wwis-dubc1-vip60.adobe.com
scanner sequence 3.ZZ.11.MDAPGF
----- EOF -----


Diagnostic Report (1.9.0027.0):
Windows Validation Data-->

Validation Code: 0
Cached Online Validation Code: 0x0
Windows Product Key: *****-*****-QCPVQ-KHRB8-RMV82
Windows Product Key Hash: +Rj3N34NLM2JqoBO/OzgzTZXgbY=
Windows Product ID: 00359-OEM-8992687-00095
Windows Product ID Type: 2
Windows License Type: OEM SLP
Windows OS version: 6.1.7600.2.00010300.0.0.003
ID: {BA49B6A2-A6C1-46C9-904D-93C5DF81645D}(1)
Is Admin: Yes
TestCab: 0x0
LegitcheckControl ActiveX: N/A, hr = 0x80070002
Signed By: N/A, hr = 0x80070002
Product Name: Windows 7 Home Premium
Architecture: 0x00000009
Build lab: 7600.win7_gdr.110408-1633
TTS Error:
Validation Diagnostic:
Resolution Status: N/A

Vista WgaER Data-->
ThreatID(s): N/A, hr = 0x80070002
Version: N/A, hr = 0x80070002

Windows XP Notifications Data-->
Cached Result: N/A, hr = 0x80070002
File Exists: No
Version: N/A, hr = 0x80070002
WgaTray.exe Signed By: N/A, hr = 0x80070002
WgaLogon.dll Signed By: N/A, hr = 0x80070002

OGA Notifications Data-->
Cached Result: N/A, hr = 0x80070002
OGAExec.exe Signed By: Microsoft
OGAAddin.dll Signed By: Microsoft

OGA Data-->
Office Status: 109 N/A
OGA Version: Registered,
Signed By: N/A, hr = 0x800b0100
Office Diagnostics: 025D1FF3-364-80041010_025D1FF3-229-80041010_025D1FF3-230-1_025D1FF3-517-80040154_025D1FF3-237-80040154_025D1FF3-238-2_025D1FF3-244-80070002_025D1FF3-258-3

Browser Data-->
Proxy settings: N/A
User Agent: Mozilla/4.0 (compatible; MSIE 8.0; Win32)
Default Browser: C:\Users\Dun\AppData\Local\Google\Chrome\Application\chrome.exe
Download signed ActiveX controls: Prompt
Download unsigned ActiveX controls: Disabled
Run ActiveX controls and plug-ins: Allowed
Initialize and script ActiveX controls not marked as safe: Disabled
Allow scripting of Internet Explorer Webbrowser control: Disabled
Active scripting: Allowed
Script ActiveX controls marked as safe for scripting: Allowed

File Scan Data-->

Other data-->
Office Details: <GenuineResults><MachineData><UGUID>{BA49B6A2-A6C1-46C9-904D-93C5DF81645D}</UGUID><Version>1.9.0027.0</Version><OS>6.1.7600.2.00010300.0.0.003</OS><Architecture>x64</Architecture><PKey>*****-*****-*****-*****-RMV82</PKey><PID>00359-OEM-8992687-00095</PID><PIDType>2</PIDType><SID>S-1-5-21-2824952906-2755450857-3828884648</SID><SYSTEM><Manufacturer>Dell Inc.</Manufacturer><Model>Studio XPS 9100</Model></SYSTEM><BIOS><Manufacturer>Dell Computer Corporation</Manufacturer><Version>A02</Version><SMBIOSVersion major="2" minor="6"/><Date>20100526000000.000000+000</Date></BIOS><HWID>35B83607018400FE</HWID><UserLCID>200A</UserLCID><SystemLCID>0C0A</SystemLCID><TimeZone>Hora estándar de Venezuela(GMT-04:30)</TimeZone><iJoin>0</iJoin><SBID><stat>3</stat><msppid></msppid><name></name><model></model></SBID><OEM><OEMID>DELL </OEMID><OEMTableID>GB10 </OEMTableID></OEM><GANotification><File Name="OGAAddin.dll" Version=""/></GANotification></MachineData><Software><Office><Result>109</Result><Products/><Applications/></Office></Software></GenuineResults>

Spsys.log Content: 0x80070002

Licensing Data-->
Versión del Servicio de licencias de software: 6.1.7600.16385

Nombre: Windows(R) 7, HomePremium edition
Descripción: Windows Operating System - Windows(R) 7, OEM_SLP channel
Id. de activación: d2c04e90-c3dd-4260-b0f3-f845f5d27d64
Id. de aplicación: 55c92734-d682-4d71-983e-d6ec3f16059f
PID extendido: 00359-00178-926-800095-02-3082-7600.0000-2992010
Id. de instalación: 000310072954562330920951074201685513598736464572263463
URL del certificado de procesador: http://go.microsoft.com/fwlink/?LinkID=88338
URL del certificado de maquina: http://go.microsoft.com/fwlink/?LinkID=88339
URL de la licencia de uso: http://go.microsoft.com/fwlink/?LinkID=88341
URL del certificado de clave de producto: http://go.microsoft.com/fwlink/?LinkID=88340
Clave de producto parcial: RMV82
Estado de la licencia: con licencia
Recuento de rearmado de Windows restante: 3
Hora de confianza: 24/07/2011 04:59:48 p.m.

Windows Activation Technologies-->
HrOffline: 0x00000000
HrOnline: 0x00000000
HealthStatus: 0x0000000000000000
Event Time Stamp: 5:22:2011 17:42
ActiveX: Registered, Version: 7.1.7600.16395
Admin Service: Registered, Version: 7.1.7600.16395
HealthStatus Bitmask Output:

HWID Data-->

OEM Activation 1.0 Data-->

OEM Activation 2.0 Data-->
BIOS valid for OA 2.0: yes
Windows marker version: 0x20001
OEMID and OEMTableID Consistent: yes
BIOS Information:
ACPI Table Name OEMID Value OEMTableID Value
SSDT DpgPmm CpuPm
Active Member
Posts: 3
Joined: July 23rd, 2011, 9:52 pm

Re: searchqu as main page and explorer doesnt work

Unread postby deltalima » July 25th, 2011, 3:18 am

You are using cracked software.

This topic is now closed
User avatar
Posts: 7614
Joined: February 28th, 2009, 4:38 pm
Location: UK
Register to Remove

  • Similar Topics
    Last post

Return to Infected? Virus, malware, adware, ransomware, oh my!

Who is online

Users browsing this forum: No registered users and 38 guests

Contact us:

Advertisements do not imply our endorsement of that product or service. Register to remove all ads. The forum is run by volunteers who donate their time and expertise. We make every attempt to ensure that the help and advice posted is accurate and will not cause harm to your computer. However, we do not guarantee that they are accurate and they are to be used at your own risk. All trademarks are the property of their respective owners.

Member site: UNITE Against Malware