Welcome to MalwareRemoval.com,
What if we told you that you could get malware removal help from experts, and that it was 100% free? MalwareRemoval.com provides free support for people with infected computers. Our help, and the tools we use are always 100% free. No hidden catch. We simply enjoy helping others. You enjoy a clean, safe computer.

Malware Removal Instructions

I Got Spigot on Win 7

MalwareRemoval.com provides free support for people with infected computers. Using plain language that anyone can understand, our community of volunteer experts will walk you through each step.

I Got Spigot on Win 7

Unread postby ejack1 » March 5th, 2011, 4:19 pm

Hello:

Computer: Home use computer only
OS: Windows 7
Virus Protection: AVG Free

Problem Discussion:
- I downloaded new drivers for my Epson Printer two days ago.
Since then, when I start my machine, I get a notice that "Search from Spigot, Inc." was prevented from changing my browser settings.
- AVG Free does not show any virus, etc. I did find a folder named, "Spigot" in "Common."
- I also disabled IE8 this morning as I suspected it had been re-enabled somehow. This scenario happened about a year ago for no known reason.
- I have also been getting plagued by JAVA to update which I also finally did yesterday to get rid of the seemingly endless prompts to update/install.
-Computer has slowed from its original state.

I don't engage in an odd web browsing behavior; no per to peer, none of that. No idea where this came from. Can you help me take care of Spigot and anything else that shouldn't be here? I will follow your directives. Happy to get rid of software, toolbars, etc., that are not needed, conflicting, mal, etc.

Thank you,

DDS Data:

.
DDS (Ver_11-03-05.01) - NTFSx86
Run by Erik at 12:04:17.08 on Sat 03/05/2011
Internet Explorer: 8.0.7600.16385 BrowserJavaVersion: 1.6.0_24
Microsoft Windows 7 Professional 6.1.7600.0.1252.1.1033.18.3327.2103 [GMT -8:00]
.
AV: AVG Anti-Virus Free Edition 2011 *Enabled/Updated* {5A2746B1-DEE9-F85A-FBCD-ADB11639C5F0}
SP: AVG Anti-Virus Free Edition 2011 *Enabled/Updated* {E146A755-F8D3-F7D4-C17D-96C36DBE8F4D}
SP: Windows Defender *Disabled/Outdated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
.
============== Running Processes ===============
.
C:\PROGRA~1\AVG\AVG10\avgchsvx.exe
C:\Windows\system32\wininit.exe
C:\Windows\system32\lsm.exe
C:\Windows\system32\svchost.exe -k DcomLaunch
C:\Windows\system32\nvvsvc.exe
C:\Windows\system32\svchost.exe -k RPCSS
C:\Windows\system32\atiesrxx.exe
C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
C:\Windows\system32\svchost.exe -k netsvcs
C:\Windows\system32\svchost.exe -k LocalService
C:\Windows\system32\svchost.exe -k NetworkService
C:\Windows\system32\atieclxx.exe
C:\Program Files\NVIDIA Corporation\Display\NvXDSync.exe
C:\Windows\system32\nvvsvc.exe
C:\Windows\System32\spoolsv.exe
C:\Windows\system32\svchost.exe -k LocalServiceNoNetwork
C:\Program Files\Application Updater\ApplicationUpdater.exe
C:\Program Files\AVG\AVG10\avgwdsvc.exe
C:\Program Files\Bonjour\mDNSResponder.exe
C:\ProgramData\EPSON\EPW!3 SSRP\E_S30RP1.EXE
C:\Windows\system32\svchost.exe -k LocalServiceAndNoImpersonation
C:\Program Files\Common Files\Microsoft Shared\VS7DEBUG\mdm.exe
C:\Windows\system32\PnkBstrA.exe
C:\Program Files\Microsoft\Search Enhancement Pack\SeaPort\SeaPort.exe
C:\Program Files\NVIDIA Corporation\3D Vision\nvSCPAPISvr.exe
C:\Windows\system32\svchost.exe -k imgsvc
C:\Program Files\TeamViewer\Version5\TeamViewer_Service.exe
C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSVC.EXE
C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSvcM.exe
C:\Program Files\AVG\AVG10\Identity Protection\Agent\Bin\AVGIDSAgent.exe
C:\Program Files\AVG\AVG10\avgnsx.exe
C:\Windows\system32\taskhost.exe
C:\Windows\system32\svchost.exe -k NetworkServiceNetworkRestricted
C:\Windows\system32\WUDFHost.exe
C:\Windows\system32\Dwm.exe
C:\Windows\Explorer.EXE
C:\Program Files\Adobe\Acrobat 8.0\Acrobat\acrotray.exe
C:\Windows\System32\rundll32.exe
C:\Program Files\AVG\AVG10\avgtray.exe
C:\Program Files\Winamp\winampa.exe
C:\Program Files\Common Files\Spigot\Search Settings\SearchSettings.exe
C:\Program Files\Common Files\Java\Java Update\jusched.exe
C:\Program Files\Windows Sidebar\sidebar.exe
C:\Windows\System32\spool\drivers\w32x86\3\E_FATIBPA.EXE
C:\Program Files\Logitech\SetPoint\SetPoint.exe
C:\Program Files\Common Files\Logishrd\KHAL2\KHALMNPR.EXE
C:\Program Files\AVG\AVG10\Identity Protection\agent\bin\avgidsmonitor.exe
C:\Windows\system32\conhost.exe
C:\Program Files\Common Files\Macrovision Shared\FLEXnet Publisher\FNPLicensingService.exe
C:\Windows\system32\SearchIndexer.exe
C:\Program Files\Windows Media Player\wmpnetwk.exe
C:\Windows\System32\svchost.exe -k LocalServicePeerNet
C:\Windows\system32\DllHost.exe
C:\PROGRA~1\AVG\AVG10\avgrsx.exe
C:\Program Files\AVG\AVG10\avgcsrvx.exe
C:\Users\Erik\AppData\Local\Google\Chrome\Application\chrome.exe
C:\Users\Erik\AppData\Local\Google\Chrome\Application\chrome.exe
C:\Users\Erik\AppData\Local\Google\Chrome\Application\chrome.exe
C:\Windows\system32\DllHost.exe
C:\Windows\system32\DllHost.exe
C:\Users\Erik\Downloads\dds.scr
C:\Windows\system32\conhost.exe
C:\Windows\system32\wbem\wmiprvse.exe
.
============== Pseudo HJT Report ===============
.
uStart Page = hxxp://www.google.com/
uSearch Bar = Preserve
uInternet Settings,ProxyOverride = *.local
uURLSearchHooks: IObit Toolbar: {0bda0769-fd72-49f4-9266-e1fb004f4d8f} - c:\program files\iobit toolbar\ie\4.3\iobitToolbarIE.dll
uURLSearchHooks: uTorrentBar Toolbar: {bf7380fa-e3b4-4db2-af3e-9d8783a45bfc} - c:\program files\utorrentbar\tbuTor.dll
mURLSearchHooks: XfireXO Toolbar: {5e5ab302-7f65-44cd-8211-c1d4caaccea3} - c:\program files\xfirexo\tbXfir.dll
mURLSearchHooks: uTorrentBar Toolbar: {bf7380fa-e3b4-4db2-af3e-9d8783a45bfc} - c:\program files\utorrentbar\tbuTor.dll
mURLSearchHooks: AVG Security Toolbar BHO: {a3bc75a2-1f87-4686-aa43-5347d756017c} - c:\program files\avg\avg10\toolbar\IEToolbar.dll
BHO: Adobe PDF Reader Link Helper: {06849e9f-c8d7-4d59-b87d-784b7d6be0b3} - c:\program files\common files\adobe\acrobat\activex\AcroIEHelper.dll
BHO: ContributeBHO Class: {074c1dc5-9320-4a9a-947d-c042949c6216} - c:\program files\adobe\/Adobe Contribute CS3/contributeieplugin.dll
BHO: IObit Toolbar: {0bda0769-fd72-49f4-9266-e1fb004f4d8f} - c:\program files\iobit toolbar\ie\4.3\iobitToolbarIE.dll
BHO: Conduit Engine: {30f9b915-b755-4826-820b-08fba6bd249d} - c:\program files\conduitengine\ConduitEngine.dll
BHO: AVG Safe Search: {3ca2f312-6f6e-4b53-a66e-4e65e497c8c0} - c:\program files\avg\avg10\avgssie.dll
BHO: Updater For ooVoo Toolbar: {442ae524-eba5-4b17-82f3-888d68bc999a} - c:\program files\oovootb\auxi\oovooAu.dll
BHO: XfireXO Toolbar: {5e5ab302-7f65-44cd-8211-c1d4caaccea3} - c:\program files\xfirexo\tbXfir.dll
BHO: Search Helper: {6ebf7485-159f-4bff-a14f-b9e3aac4465b} - c:\program files\microsoft\search enhancement pack\search helper\SEPsearchhelperie.dll
BHO: Windows Live ID Sign-in Helper: {9030d464-4c02-4abf-8ecc-5164760863c6} - c:\program files\common files\microsoft shared\windows live\WindowsLiveLogin.dll
BHO: Windows Live Messenger Companion Helper: {9fdde16b-836f-4806-ab1f-1455cbeff289} - c:\program files\windows live\companion\companioncore.dll
BHO: ooVoo Toolbar: {a1fb2f9a-d35e-11dd-8935-e46a56d89593} - c:\program files\oovootb\oovoodx.dll
BHO: AVG Security Toolbar BHO: {a3bc75a2-1f87-4686-aa43-5347d756017c} - c:\program files\avg\avg10\toolbar\IEToolbar.dll
BHO: Adobe PDF Conversion Toolbar Helper: {ae7cd045-e861-484f-8273-0445ee161910} - c:\program files\adobe\acrobat 8.0\acrobat\AcroIEFavClient.dll
BHO: Skype add-on for Internet Explorer: {ae805869-2e5c-4ed4-8f7b-f1f7851a4497} - c:\program files\skype\toolbars\internet explorer\skypeieplugin.dll
BHO: uTorrentBar Toolbar: {bf7380fa-e3b4-4db2-af3e-9d8783a45bfc} - c:\program files\utorrentbar\tbuTor.dll
BHO: Bing Bar BHO: {d2ce3e00-f94a-4740-988e-03dc2f38c34f} - c:\program files\msn toolbar\platform\6.3.2322.0\npwinext.dll
BHO: Java(tm) Plug-In 2 SSV Helper: {dbc80044-a445-435b-bc74-9c25c1c588a9} - c:\program files\java\jre6\bin\jp2ssv.dll
TB: AVG Security Toolbar: {ccc7a320-b3ca-4199-b1a6-9f516dd69829} - c:\program files\avg\avg10\toolbar\IEToolbar.dll
TB: XfireXO Toolbar: {5e5ab302-7f65-44cd-8211-c1d4caaccea3} - c:\program files\xfirexo\tbXfir.dll
TB: Adobe PDF: {47833539-d0c5-4125-9fa8-0819e2eaac93} - c:\program files\adobe\acrobat 8.0\acrobat\AcroIEFavClient.dll
TB: Contribute Toolbar: {517bdde4-e3a7-4570-b21e-2b52b6139fc7} - c:\program files\adobe\/Adobe Contribute CS3/contributeieplugin.dll
TB: ooVoo Toolbar: {a1fb2f9a-d35e-11dd-8935-e46a56d89593} - c:\program files\oovootb\oovoodx.dll
TB: uTorrentBar Toolbar: {bf7380fa-e3b4-4db2-af3e-9d8783a45bfc} - c:\program files\utorrentbar\tbuTor.dll
TB: Conduit Engine: {30f9b915-b755-4826-820b-08fba6bd249d} - c:\program files\conduitengine\ConduitEngine.dll
TB: @c:\program files\msn toolbar\platform\6.3.2322.0\npwinext.dll,-100: {8dcb7100-df86-4384-8842-8fa844297b3f} - c:\program files\msn toolbar\platform\6.3.2322.0\npwinext.dll
TB: IObit Toolbar: {0bda0769-fd72-49f4-9266-e1fb004f4d8f} - c:\program files\iobit toolbar\ie\4.3\iobitToolbarIE.dll
EB: Adobe PDF: {182ec0be-5110-49c8-a062-beb1d02a220b} - c:\program files\adobe\acrobat 8.0\acrobat\AcroIEFavClient.dll
uRun: [Google Update] "c:\users\erik\appdata\local\google\update\GoogleUpdate.exe" /c
uRun: [Sidebar] c:\program files\windows sidebar\sidebar.exe /autoRun
uRun: [EPSON Stylus Photo RX580 Series] c:\windows\system32\spool\drivers\w32x86\3\e_fatibpa.exe /fu "c:\windows\temp\E_S8D68.tmp" /EF "HKCU"
mRun: [Acrobat Assistant 8.0] "c:\program files\adobe\acrobat 8.0\acrobat\Acrotray.exe"
mRun: [Kernel and Hardware Abstraction Layer] KHALMNPR.EXE
mRun: [NetFxUpdate_v1.1.4322] "c:\windows\microsoft.net\framework\v1.1.4322\netfxupdate.exe" 1 v1.1.4322 GAC + NI NID
mRun: [VF0060 STISvc] RunDLL32.exe V0060Pin.dll,RunDLL32EP 513
mRun: [AVG_TRAY] c:\program files\avg\avg10\avgtray.exe
mRun: [WinampAgent] "c:\program files\winamp\winampa.exe"
mRun: [<NO NAME>]
mRun: [SearchSettings] "c:\program files\common files\spigot\search settings\SearchSettings.exe"
mRun: [SunJavaUpdateSched] "c:\program files\common files\java\java update\jusched.exe"
StartupFolder: c:\progra~2\micros~1\windows\startm~1\programs\startup\logite~1.lnk - c:\program files\logitech\setpoint\SetPoint.exe
mPolicies-system: ConsentPromptBehaviorAdmin = 5 (0x5)
mPolicies-system: ConsentPromptBehaviorUser = 3 (0x3)
mPolicies-system: EnableUIADesktopToggle = 0 (0x0)
IE: {0000036B-C524-4050-81A0-243669A86B9F} - {B63DBA5F-523F-4B9C-A43D-65DF1977EAD3} - c:\program files\windows live\companion\companioncore.dll
IE: {219C3416-8CB2-491a-A3C7-D9FCDDC9D600} - {5F7B1267-94A9-47F5-98DB-E99415F33AEC} - c:\program files\windows live\writer\WriterBrowserExtension.dll
IE: {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - c:\program files\skype\toolbars\internet explorer\skypeieplugin.dll
IE: {92780B25-18CC-41C8-B9BE-3C9C571A8263} - {FF059E31-CC5A-4E2E-BF3B-96E929D65503} - c:\progra~1\mif5ba~1\office12\REFIEBAR.DLL
Trusted Zone: aol.com\free
DPF: {8AD9C840-044E-11D1-B3E9-00805F499D93} - hxxp://java.sun.com/update/1.6.0/jinsta ... s-i586.cab
DPF: {CAFEEFAC-0016-0000-0024-ABCDEFFEDCBA} - hxxp://java.sun.com/update/1.6.0/jinsta ... s-i586.cab
DPF: {CAFEEFAC-FFFF-FFFF-FFFF-ABCDEFFEDCBA} - hxxp://java.sun.com/update/1.6.0/jinsta ... s-i586.cab
DPF: {D27CDB6E-AE6D-11CF-96B8-444553540000} - hxxp://fpdownload2.macromedia.com/get/s ... wflash.cab
Handler: avgsecuritytoolbar - {F2DDE6B2-9684-4A55-86D4-E255E237B77C} - c:\program files\avg\avg10\toolbar\IEToolbar.dll
Handler: linkscanner - {F274614C-63F8-47D5-A4D1-FBDDE494F8D1} - c:\program files\avg\avg10\avgpp.dll
Handler: skype-ie-addon-data - {91774881-D725-4E58-B298-07617B9B86A8} - c:\program files\skype\toolbars\internet explorer\skypeieplugin.dll
Handler: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - c:\progra~1\common~1\skype\SKYPE4~1.DLL
Handler: wlpg - {E43EF6CD-A37A-4A9B-9E6F-83F89B8E6324} - c:\program files\windows live\photo gallery\AlbumDownloadProtocolHandler.dll
Notify: LBTWlgn - c:\program files\common files\logishrd\bluetooth\LBTWlgn.dll
.
================= FIREFOX ===================
.
FF - ProfilePath - c:\users\erik\appdata\roaming\mozilla\firefox\profiles\hacx6vcb.default\
FF - prefs.js: browser.search.selectedEngine - Yahoo
FF - prefs.js: browser.startup.homepage - hxxp://google.com
FF - prefs.js: keyword.URL - hxxp://search.yahoo.com/search?fr=green ... =382950&p=
FF - prefs.js: browser.search.selectedEngine - Yahoo
FF - prefs.js: keyword.URL - hxxp://search.yahoo.com/search?fr=green ... =382950&p=
FF - component: c:\program files\avg\avg10\firefox\components\avgssff.dll
FF - component: c:\program files\common files\spigot\wtxpcom\components\WidgiToolbarFF.dll
FF - plugin: c:\program files\java\jre6\bin\new_plugin\npdeployJava1.dll
FF - plugin: c:\program files\nvidia corporation\3d vision\npnv3dv.dll
FF - plugin: c:\program files\nvidia corporation\3d vision\npnv3dvstreaming.dll
FF - plugin: c:\program files\windows live\photo gallery\NPWLPG.dll
FF - plugin: c:\users\erik\appdata\local\google\update\1.2.183.39\npGoogleOneClick8.dll
FF - plugin: c:\users\erik\appdata\local\yahoo!\browserplus\2.9.8\plugins\npybrowserplus_2.9.8.dll
FF - plugin: c:\users\erik\appdata\roaming\mozilla\firefox\profiles\hacx6vcb.default\extensions\battlefieldplay4free@ea.com\platform\winnt_x86-msvc\plugins\npBP4FUpdater.dll
FF - Ext: Default: {972ce4c6-7e08-4474-a285-3208198ce6fd} - c:\program files\mozilla firefox\extensions\{972ce4c6-7e08-4474-a285-3208198ce6fd}
FF - Ext: Java Console: {CAFEEFAC-0016-0000-0023-ABCDEFFEDCBA} - c:\program files\mozilla firefox\extensions\{CAFEEFAC-0016-0000-0023-ABCDEFFEDCBA}
FF - Ext: AVG Safe Search: {3f963a5b-e555-4543-90e2-c3908898db71} - c:\program files\avg\avg10\Firefox
FF - Ext: Battlefield Play4Free: battlefieldplay4free@ea.com - %profile%\extensions\battlefieldplay4free@ea.com
.
============= SERVICES / DRIVERS ===============
.
R0 AVGIDSEH;AVGIDSEH;c:\windows\system32\drivers\AVGIDSEH.sys [2010-9-13 25680]
R0 Avgrkx86;AVG Anti-Rootkit Driver;c:\windows\system32\drivers\avgrkx86.sys [2010-9-7 26064]
R1 Avgldx86;AVG AVI Loader Driver;c:\windows\system32\drivers\avgldx86.sys [2010-12-8 251728]
R1 Avgmfx86;AVG Mini-Filter Resident Anti-Virus Shield;c:\windows\system32\drivers\avgmfx86.sys [2010-9-7 34384]
R1 Avgtdix;AVG TDI Driver;c:\windows\system32\drivers\avgtdix.sys [2010-11-12 299984]
R2 AMD External Events Utility;AMD External Events Utility;c:\windows\system32\atiesrxx.exe [2009-8-18 176128]
R2 Application Updater;Application Updater;c:\program files\application updater\ApplicationUpdater.exe [2011-1-28 387072]
R2 AVGIDSAgent;AVGIDSAgent;c:\program files\avg\avg10\identity protection\agent\bin\AVGIDSAgent.exe [2011-1-6 6128720]
R2 avgwd;AVG WatchDog;c:\program files\avg\avg10\avgwdsvc.exe [2010-10-22 265400]
R2 Stereo Service;NVIDIA Stereoscopic 3D Driver Service;c:\program files\nvidia corporation\3d vision\nvSCPAPISvr.exe [2010-10-16 369256]
R2 TeamViewer5;TeamViewer 5;c:\program files\teamviewer\version5\TeamViewer_Service.exe [2010-7-6 173352]
R3 AVGIDSDriver;AVGIDSDriver;c:\windows\system32\drivers\AVGIDSDriver.sys [2010-8-19 123472]
R3 AVGIDSFilter;AVGIDSFilter;c:\windows\system32\drivers\AVGIDSFilter.sys [2010-8-19 30288]
R3 AVGIDSShim;AVGIDSShim;c:\windows\system32\drivers\AVGIDSShim.sys [2010-8-19 21072]
R3 L1C;NDIS Miniport Driver for Atheros AR813x/AR815x PCI-E Ethernet Controller;c:\windows\system32\drivers\L1C62x86.sys [2009-11-13 58368]
S2 clr_optimization_v4.0.30319_32;Microsoft .NET Framework NGEN v4.0.30319_X86;c:\windows\microsoft.net\framework\v4.0.30319\mscorsvw.exe [2010-3-18 130384]
S3 AVG Security Toolbar Service;AVG Security Toolbar Service;c:\program files\avg\avg10\toolbar\ToolbarBroker.exe [2010-10-27 517448]
S3 b57nd60x;Broadcom NetXtreme Gigabit Ethernet - NDIS 6.0;c:\windows\system32\drivers\b57nd60x.sys [2009-7-13 229888]
S3 fssfltr;fssfltr;c:\windows\system32\drivers\fssfltr.sys [2010-10-21 39272]
S3 fsssvc;Windows Live Family Safety Service;c:\program files\windows live\family safety\fsssvc.exe [2010-9-22 1493352]
S3 StorSvc;Storage Service;c:\windows\system32\svchost.exe -k LocalSystemNetworkRestricted [2009-7-13 20992]
S3 V0060VID;Creative WebCam Live! Ultra;c:\windows\system32\drivers\V0060Vid.sys [2010-10-1 196409]
S3 WatAdminSvc;Windows Activation Technologies Service;c:\windows\system32\wat\WatAdminSvc.exe [2010-5-22 1343400]
S4 wlcrasvc;Windows Live Mesh remote connections service;c:\program files\windows live\mesh\wlcrasvc.exe [2010-9-22 51040]
.
=============== Created Last 30 ================
.
2011-03-05 04:49:20 -------- d-----w- c:\program files\IObit Toolbar
2011-03-05 04:49:20 -------- d-----w- c:\program files\Application Updater
2011-03-04 15:16:31 -------- d-----w- c:\users\erik\appdata\local\{97B5ED05-9358-45B1-B367-00A3F3DA8484}
2011-03-02 16:16:53 -------- d-----w- c:\users\erik\appdata\local\{3973821A-4368-46AB-879B-A25C911EB86C}
2011-03-01 18:47:50 -------- d-----w- c:\users\erik\appdata\local\{A2CB3EC2-8720-4DDD-BF14-A52337A45F34}
2011-02-26 01:19:32 41872 ----a-w- c:\windows\system32\xfcodec.dll
2011-02-25 22:31:50 -------- d-----w- c:\program files\Epson Software
2011-02-25 22:27:46 -------- d-----w- c:\progra~2\EPSON
2011-02-25 22:22:42 212480 ----a-w- c:\windows\PCDLIB32.DLL
2011-02-25 22:14:52 -------- d-----w- c:\program files\EPSON Print CD
2011-02-25 22:14:45 696320 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\iKernel.dll
2011-02-25 22:14:45 57344 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\ctor.dll
2011-02-25 22:14:45 5632 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\DotNetInstaller.exe
2011-02-25 22:14:45 282756 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\setup.dll
2011-02-25 22:14:45 237568 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\iscript.dll
2011-02-25 22:14:45 163972 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\iGdi.dll
2011-02-25 22:14:45 155648 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\iuser.dll
2011-02-25 22:10:40 80024 ----a-w- c:\windows\system32\PICSDK.dll
2011-02-25 22:10:40 51360 ----a-w- c:\windows\system32\EpPicPrt.dll
2011-02-25 22:10:40 51360 ----a-w- c:\windows\system32\EpPicMgr.dll
2011-02-25 22:10:40 501912 ----a-w- c:\windows\system32\PICSDK2.dll
2011-02-25 22:10:40 108704 ----a-w- c:\windows\system32\PICEntry.dll
2011-02-25 22:09:01 -------- d-----w- c:\program files\epson
2011-02-25 22:09:00 61952 ----a-w- c:\windows\system32\escwiad.dll
2011-02-25 21:52:39 -------- d-----w- c:\progra~2\SSScanAppDataDir
2011-02-25 21:52:32 -------- d-----w- c:\progra~2\MSScanAppDataDir
2011-02-24 00:49:47 276992 ----a-w- c:\windows\system32\wcncsvc.dll
2011-02-23 15:09:38 442880 ----a-w- c:\windows\system32\XpsPrint.dll
2011-02-23 15:09:38 288256 ----a-w- c:\windows\system32\XpsGdiConverter.dll
2011-02-17 03:19:47 -------- d-----w- c:\users\erik\appdata\local\{643409F1-35F6-4A79-AF55-4619BA74ACD2}
2011-02-12 18:07:06 -------- d-----w- c:\users\erik\appdata\local\{A5A0FA6A-460E-4AE8-B085-6629779AF69D}
2011-02-12 17:07:19 472808 ----a-w- c:\program files\mozilla firefox\plugins\npdeployJava1.dll
2011-02-10 22:54:40 -------- d-----w- c:\users\erik\appdata\local\Aptana Studio 2.0
2011-02-08 16:38:10 -------- d-----w- c:\users\erik\appdata\local\{3D965CD1-D675-4B8F-BF48-C6EB6A7712D1}
.
==================== Find3M ====================
.
2011-02-27 22:33:35 234536 ----a-w- c:\windows\system32\PnkBstrB.xtr
2011-02-27 22:33:35 234536 ----a-w- c:\windows\system32\PnkBstrB.exe
2011-02-27 22:33:28 215128 ----a-w- c:\windows\system32\PnkBstrB.ex0
2011-02-03 05:40:23 472808 ----a-w- c:\windows\system32\deployJava1.dll
2011-01-07 07:27:11 34304 ----a-w- c:\windows\system32\atmlib.dll
2011-01-07 05:33:11 294400 ----a-w- c:\windows\system32\atmfd.dll
2011-01-05 05:37:33 428032 ----a-w- c:\windows\system32\vbscript.dll
2011-01-05 03:37:38 2329088 ----a-w- c:\windows\system32\win32k.sys
2011-01-04 21:15:02 75136 ----a-w- c:\windows\system32\PnkBstrA.exe
2010-12-21 05:38:24 73728 ----a-w- c:\windows\system32\wscsvc.dll
2010-12-21 05:38:24 51200 ----a-w- c:\windows\system32\wscapi.dll
2010-12-21 05:38:22 981504 ----a-w- c:\windows\system32\wininet.dll
2010-12-21 05:38:22 350720 ----a-w- c:\windows\system32\winhttp.dll
2010-12-21 05:38:21 204800 ----a-w- c:\windows\system32\WebClnt.dll
2010-12-21 05:38:19 204288 ----a-w- c:\windows\system32\upnp.dll
2010-12-21 05:38:16 14336 ----a-w- c:\windows\system32\slwga.dll
2010-12-21 05:36:17 1389568 ----a-w- c:\windows\system32\msxml6.dll
2010-12-21 05:36:16 1236992 ----a-w- c:\windows\system32\msxml3.dll
2010-12-21 05:34:12 80384 ----a-w- c:\windows\system32\davclnt.dll
2010-12-18 05:29:40 44544 ----a-w- c:\windows\system32\licmgr10.dll
2010-12-18 05:29:31 541184 ----a-w- c:\windows\system32\kerberos.dll
2010-12-18 04:20:55 386048 ----a-w- c:\windows\system32\html.iec
2010-12-18 03:47:59 1638912 ----a-w- c:\windows\system32\mshtml.tlb
2010-12-17 05:21:06 138056 ----a-w- c:\users\erik\appdata\roaming\PnkBstrK.sys
.
============= FINISH: 12:04:33.32 ===============


ATTACH DATA:

.
UNLESS SPECIFICALLY INSTRUCTED, DO NOT POST THIS LOG.
IF REQUESTED, ZIP IT UP & ATTACH IT
.
DDS (Ver_11-03-05.01)
.
Microsoft Windows 7 Professional
Boot Device: \Device\HarddiskVolume1
Install Date: 5/21/2010 8:25:06 PM
System Uptime: 3/5/2011 10:00:43 AM (2 hours ago)
.
Motherboard: ASUSTeK Computer INC. | | M4A78LT-M-LE
Processor: AMD Athlon(tm) II X4 630 Processor | AM3 | 2800/200mhz
.
==== Disk Partitions =========================
.
C: is FIXED (NTFS) - 466 GiB total, 357.351 GiB free.
E: is Removable
F: is Removable
G: is Removable
H: is Removable
I: is FIXED (NTFS) - 466 GiB total, 441.212 GiB free.
.
==== Disabled Device Manager Items =============
.
Class GUID: {4d36e965-e325-11ce-bfc1-08002be10318}
Description: CD-ROM Drive
Device ID: IDE\CDROMOPTIARC_DVD_RW_AD-7241S_________________1.03____\5&F437AB5&0&0.1.0
Manufacturer: (Standard CD-ROM drives)
Name: Optiarc DVD RW AD-7241S ATA Device
PNP Device ID: IDE\CDROMOPTIARC_DVD_RW_AD-7241S_________________1.03____\5&F437AB5&0&0.1.0
Service: cdrom
.
==== System Restore Points ===================
.
RP129: 2/23/2011 4:49:27 PM - Windows Update
RP131: 2/25/2011 2:09:13 PM - Installed EPSON Stylus Photo RX580 Scanner Driver Update
RP133: 2/25/2011 2:10:32 PM - Installed EPSON EasyPrintModule
RP135: 2/25/2011 2:14:46 PM - Installed EPSON Print CD
RP137: 2/25/2011 2:22:34 PM - Installed PhotoImpression
RP139: 2/25/2011 2:31:11 PM - Installed Epson CreativeZone
RP141: 2/25/2011 2:31:50 PM - Installed Epson Print CD
RP142: 3/4/2011 8:50:19 PM - Installed Java(TM) 6 Update 24
RP143: 3/4/2011 8:51:34 PM - Installed Java Runtime Environment
RP144: 3/5/2011 8:31:40 AM - Windows Modules Installer
.
==== Installed Programs ======================
.
µTorrent
Add or Remove Adobe Creative Suite 3 Master Collection
Adobe Acrobat 8 Professional
Adobe After Effects CS3
Adobe After Effects CS3 Presets
Adobe Anchor Service CS3
Adobe Asset Services CS3
Adobe Bridge CS3
Adobe Bridge Start Meeting
Adobe BridgeTalk Plugin CS3
Adobe Camera Raw 4.0
Adobe CMaps
Adobe Color - Photoshop Specific
Adobe Color Common Settings
Adobe Color EU Extra Settings
Adobe Color JA Extra Settings
Adobe Color NA Recommended Settings
Adobe Contribute CS3
Adobe Creative Suite 3 Master Collection
Adobe Default Language CS3
Adobe Device Central CS3
Adobe Dreamweaver CS3
Adobe Encore CS3
Adobe Encore CS3 Codecs
Adobe ExtendScript Toolkit 2
Adobe Extension Manager CS3
Adobe Fireworks CS3
Adobe Flash CS3
Adobe Flash Player 10 ActiveX
Adobe Flash Player 10 Plugin
Adobe Flash Video Encoder
Adobe Fonts All
Adobe Help Viewer CS3
Adobe Illustrator CS3
Adobe InDesign CS3
Adobe InDesign CS3 Icon Handler
Adobe Linguistics CS3
Adobe MotionPicture Color Files
Adobe PDF Library Files
Adobe Photoshop CS3
Adobe Premiere Pro CS3
Adobe Premiere Pro CS3 Functional Content
Adobe Premiere Pro CS3 Third Party Content
Adobe Setup
Adobe SING CS3
Adobe Soundbooth CS3
Adobe Soundbooth CS3 Codecs
Adobe Stock Photos CS3
Adobe Type Support
Adobe Update Manager CS3
Adobe Version Cue CS3 Client
Adobe Version Cue CS3 Server
Adobe Video Profiles
Adobe WAS CS3
Adobe WinSoft Linguistics Plugin
Adobe XMP DVA Panels CS3
Adobe XMP Panels CS3
AHV content for Acrobat and Flash
Alien Swarm
Allied Intent Xtended 2.0
Aptana Studio 2.0
ArcSoft PhotoImpression 5
AVG 2011
AVG PC Tuneup 2011
Battlefield 2(TM)
Battlefield Play4Free
Battlefield: Bad Company 2
Bing Bar
Bing Bar Platform
Call of Duty(R) 4 - Modern Warfare(TM)
Call of Duty(R) 4 - Modern Warfare(TM) 1.7 Patch
Call of Duty: Black Ops
Call of Duty: Black Ops - Multiplayer
CDDRV_Installer
Conduit Engine
Creative WebCam Center
Creative WebCam Live! Ultra Driver (1.01.03.0127)
Creative WebCam Live! Ultra User's Guide (English)
D3DX10
Epson Print CD
EPSON Printer Software
EPSON Scan
EPSON Stylus Photo RX580 Scanner Driver Update
EPSON Stylus Photo RX580 User's Guide
erLT
FileZilla Client 3.3.5.1
FreeApps
GameSpy Arcade
Get Yahoo! Messenger
Google Chrome
GTactix
HyperLobby client
IL-2 Sturmovik: 1946
Internet TV for Windows Media Center
IObit Toolbar v4.3
Java Auto Updater
Java(TM) 6 Update 24
Junk Mail filter update
KhalInstallWrapper
Logitech SetPoint
Mesh Runtime
Messenger Companion
Microsoft .NET Framework 1.1
Microsoft .NET Framework 4 Client Profile
Microsoft Application Error Reporting
Microsoft Office 2007 Service Pack 2 (SP2)
Microsoft Office Access MUI (English) 2007
Microsoft Office Access Setup Metadata MUI (English) 2007
Microsoft Office Excel MUI (English) 2007
Microsoft Office InfoPath MUI (English) 2007
Microsoft Office Outlook Connector
Microsoft Office Outlook MUI (English) 2007
Microsoft Office PowerPoint MUI (English) 2007
Microsoft Office Professional Plus 2007
Microsoft Office Proof (English) 2007
Microsoft Office Proof (French) 2007
Microsoft Office Proof (Spanish) 2007
Microsoft Office Proofing (English) 2007
Microsoft Office Proofing Tools 2007 Service Pack 2 (SP2)
Microsoft Office Publisher MUI (English) 2007
Microsoft Office Shared MUI (English) 2007
Microsoft Office Shared Setup Metadata MUI (English) 2007
Microsoft Office Word MUI (English) 2007
Microsoft Search Enhancement Pack
Microsoft Silverlight
Microsoft SQL Server 2005 Compact Edition [ENU]
Microsoft Visual C++ 2005 Redistributable
Microsoft Visual C++ 2008 ATL Update kb973924 - x86 9.0.30729.4148
Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.17
Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.4148
Mozilla Firefox (3.6.13)
MSVCRT
NVIDIA 3D Vision Driver 260.99
NVIDIA Control Panel 260.99
NVIDIA Graphics Driver 260.99
NVIDIA Install Application
NVIDIA PhysX
NVIDIA PhysX System Software 9.10.0514
NVIDIA Stereoscopic 3D Driver
OGA Notifier 2.0.0048.0
ooVoo
ooVoo Toolbar (Remove Toolbar Only)
PDF Settings
PunkBuster Services
PVSonyDll
Security Update for 2007 Microsoft Office System (KB2288621)
Security Update for 2007 Microsoft Office System (KB2288931)
Security Update for 2007 Microsoft Office System (KB2289158)
Security Update for 2007 Microsoft Office System (KB2344875)
Security Update for 2007 Microsoft Office System (KB2345043)
Security Update for 2007 Microsoft Office System (KB969559)
Security Update for 2007 Microsoft Office System (KB976321)
Security Update for CAPICOM (KB931906)
Security Update for Microsoft Office Access 2007 (KB979440)
Security Update for Microsoft Office Excel 2007 (KB2345035)
Security Update for Microsoft Office InfoPath 2007 (KB979441)
Security Update for Microsoft Office PowerPoint 2007 (KB982158)
Security Update for Microsoft Office PowerPoint Viewer (KB2413381)
Security Update for Microsoft Office Publisher 2007 (KB2284697)
Security Update for Microsoft Office system 2007 (972581)
Security Update for Microsoft Office system 2007 (KB974234)
Security Update for Microsoft Office Visio Viewer 2007 (KB973709)
Security Update for Microsoft Office Word 2007 (KB2344993)
Skype Toolbars
Skype™ 4.2
Smart Defrag
Steam
Stellarium 0.10.5
TeamSpeak 3 Client
TeamViewer 5
Update for 2007 Microsoft Office System (KB967642)
Update for Microsoft Office 2007 Help for Common Features (KB963673)
Update for Microsoft Office Access 2007 Help (KB963663)
Update for Microsoft Office Excel 2007 Help (KB963678)
Update for Microsoft Office Infopath 2007 Help (KB963662)
Update for Microsoft Office Outlook 2007 (KB2412171)
Update for Microsoft Office Outlook 2007 Help (KB963677)
Update for Microsoft Office Powerpoint 2007 Help (KB963669)
Update for Microsoft Office Publisher 2007 Help (KB963667)
Update for Microsoft Office Script Editor Help (KB963671)
Update for Microsoft Office Word 2007 Help (KB963665)
Update for Outlook 2007 Junk Email Filter (KB2492475)
uTorrentBar Toolbar
Ventrilo Client
VLC media player 1.1.5
Winamp
Winamp Detector Plug-in
Windows Live Communications Platform
Windows Live Essentials
Windows Live Family Safety
Windows Live ID Sign-in Assistant
Windows Live Installer
Windows Live Mail
Windows Live Mesh
Windows Live Mesh ActiveX Control for Remote Connections
Windows Live Messenger
Windows Live Messenger Companion Core
Windows Live MIME IFilter
Windows Live Movie Maker
Windows Live Photo Common
Windows Live Photo Gallery
Windows Live PIMT Platform
Windows Live Remote Client
Windows Live Remote Client Resources
Windows Live Remote Service
Windows Live Remote Service Resources
Windows Live SOXE
Windows Live SOXE Definitions
Windows Live Sync
Windows Live UX Platform
Windows Live UX Platform Language Pack
Windows Live Writer
Windows Live Writer Resources
Windows Media Center Add-in for Flash
Windows Media Player Firefox Plugin
World of Tanks Closed Beta v.0.5.4.1
Xfire (remove only)
XfireXO Toolbar
Yahoo! BrowserPlus 2.9.8
.
==== Event Viewer Messages From Past Week ========
.
3/5/2011 10:01:07 AM, Error: volmgr [46] - Crash dump initialization failed!
2/26/2011 4:18:34 PM, Error: Service Control Manager [7009] - A timeout was reached (30000 milliseconds) while waiting for the Steam Client Service service to connect.
2/26/2011 4:18:34 PM, Error: Service Control Manager [7000] - The Steam Client Service service failed to start due to the following error: The service did not respond to the start or control request in a timely fashion.
.
==== End Of File ===========================
ejack1
Active Member
 
Posts: 11
Joined: July 13th, 2008, 6:27 pm
Advertisement
Register to Remove

Re: I Got Spigot on Win 7

Unread postby Carolyn » March 5th, 2011, 4:24 pm

Hi - I'm checking your logs. Be right back...
User avatar
Carolyn
MRU Emeritus
MRU Emeritus
 
Posts: 4701
Joined: April 18th, 2007, 9:36 am
Location: Maine

Re: I Got Spigot on Win 7

Unread postby Carolyn » March 5th, 2011, 4:40 pm

Hello and Welcome to the forums!

My name is Carolyn and I'll be glad to help you with your computer problems.

Please do not run any other tool untill instructed to do so!
Please reply to this thread, do not start another!
Please tell me about any problems that have occurred during the fix.
Please tell me of any other symptoms you may be having as these can help also.
Please try as much as possible not to run anything while executing a fix.

If you follow these instructions, everything should go smoothly.


With reference to Malware Removal P2P Programs Policy, please uninstall the following programs before we continue:

  1. Click on Start > Control Panel and double click on programs and features.
  2. Locate µTorrent and click on the Uninstall button to uninstall it.
  3. Repeat for uTorrentBar Toolbar and any other P2P programs that may be installed.

=====================================

Download CKScanner from here
Important - Save it to your desktop.
Right-click CKScanner.exe, select Run as administrator then click Search For Files.
After a very short time, when the cursor hourglass disappears, click Save List To File.
A message box will verify the file saved.
Double-click the CKFiles.txt icon on your desktop and copy/paste the contents in your next reply.
User avatar
Carolyn
MRU Emeritus
MRU Emeritus
 
Posts: 4701
Joined: April 18th, 2007, 9:36 am
Location: Maine

Re: I Got Spigot on Win 7

Unread postby ejack1 » March 5th, 2011, 4:51 pm

CKScanner - Additional Security Risks - These are not necessarily bad
c:\program files\adobe\adobe premiere pro cs3\plug-ins\en_us\vstplugins\decrackler1.dll
c:\program files\adobe\adobe premiere pro cs3\plug-ins\en_us\vstplugins\decrackler2.dll
c:\program files\adobe\adobe premiere pro cs3\plug-ins\en_us\vstplugins\decrackler6.dll
c:\program files\steam\steamapps\common\call of duty black ops\zone\common\mp_cracked.ff
c:\program files\steam\steamapps\common\call of duty black ops\zone\english\en_mp_cracked.ff
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-214c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetailcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_2\rashaderstmbasedetaildirtcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetailcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-6178-53311dc2c535}_3153_3\rashaderstmbasedetaildirtcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetailcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_3153_2\rashaderstmbasedetaildirtcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetailcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_2\rashaderstmbasedetaildirtcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetailcrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\users\erik\documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-5571-82a3a1c2c535}_3153_3\rashaderstmbasedetaildirtcrackshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrack.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackalphatest.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatest.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatestlightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatestpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmapalphatestshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmaplightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmaplightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmappointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackenvmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcracklightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcracklightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatest.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatestpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapalphatestshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmaplightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmaplightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmappointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackenvmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetailcrackshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrack.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcracklightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\users\erik\documents\battlefield play4free\mods\main\cache\{d7b71e3e-4555-11cf-fa4c-54311cc2c535}_218318_4\rashaderstmbasedetaildirtcrackshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrack.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackalphatest.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcracklightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcracklightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrack.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetailcrackshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrack.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcracklightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\windows.old\documents and settings\john knight\my documents\battlefield 2\mods\bf2\cache\{d7b71ee2-d556-11cf-b468-82a3a1c2cb35}_3153_3\rashaderstmbasedetaildirtcrackshadow.cfx
scanner sequence 3.ZZ.11
----- EOF -----
ejack1
Active Member
 
Posts: 11
Joined: July 13th, 2008, 6:27 pm

Re: I Got Spigot on Win 7

Unread postby Carolyn » March 5th, 2011, 5:31 pm

Illegal Software Detected
While going through your log it has come to my attention that your version of Call of Duty(R) 4 - Modern Warfare(TM) 1.7 Patch is cracked and that it appears you are actively using it.
This forum's policy says we will not help people who use cracked or pirated software.

More information:
Illegal Copies of Software

If you still want me to help you I suggest you purchase a legal copy of the software or remove the cracked software from your computer.
NOTE: If you give me advice that the software has been removed & I find it has not (the tools we use can & will detect it) then I will have no choice but to have this thread closed.
Please decide what you are going to do & let me know.
User avatar
Carolyn
MRU Emeritus
MRU Emeritus
 
Posts: 4701
Joined: April 18th, 2007, 9:36 am
Location: Maine

Re: I Got Spigot on Win 7

Unread postby ejack1 » March 5th, 2011, 5:37 pm

No, that is not true. I purchased my copy of Call of Duty from a store (I believe it was Best Buy or Game Stop-I found the original packaging and key code) (and several other games from Steam) and registered the product. If there is some way to prove that to you, just let me know. I don't know how they update their patches or improvements but my game is a legal game; maybe they do it in such as way that it appears to you that it is not legitimate but I am sure it is. I think they run patches for it quite a bit.

Also- I don't know how to read the logs as you do, but I do see the name John Knight. He was the person I bought this computer used from a while ago. I did the System 7 upgrade from his Xp. I thought it would erase references to him, but it doesn't look like it did. Perhaps he had a cracked game but I don't.

Please let me know how to help regarding this.

Thank you,

Erik
PS- I just found the Best Buy receipt from 6/19/2010 for $34.10. I can scan and post it for you if that helps.
ejack1
Active Member
 
Posts: 11
Joined: July 13th, 2008, 6:27 pm

Re: I Got Spigot on Win 7

Unread postby Carolyn » March 5th, 2011, 6:06 pm

PS- I just found the Best Buy receipt from 6/19/2010 for $34.10. I can scan and post it for you if that helps.


I've asked for some feedback on this from other helpers here. I'll post back as soon as I can.

Thank you for your patience.
User avatar
Carolyn
MRU Emeritus
MRU Emeritus
 
Posts: 4701
Joined: April 18th, 2007, 9:36 am
Location: Maine

Re: I Got Spigot on Win 7

Unread postby Carolyn » March 5th, 2011, 6:11 pm

Erik,

While we wait for the feedback which I requested, please post a fresh set of DDS.txt and Attach.txt logs.
User avatar
Carolyn
MRU Emeritus
MRU Emeritus
 
Posts: 4701
Joined: April 18th, 2007, 9:36 am
Location: Maine

Re: I Got Spigot on Win 7

Unread postby ejack1 » March 5th, 2011, 6:16 pm

Ok, no problem. Just let me know what I can do to help you help me. I'm not into pirated anything.
I play several online games but I don't know the technical behind how they work. I think Call of Duty 4 is an older one.
If I need to uninstall that patch; if you tell me how to do it, I can.

Thank you,

Erik


.
DDS (Ver_11-03-05.01) - NTFSx86
Run by Erik at 14:13:09.44 on Sat 03/05/2011
Internet Explorer: 8.0.7600.16385 BrowserJavaVersion: 1.6.0_24
Microsoft Windows 7 Professional 6.1.7600.0.1252.1.1033.18.3327.1939 [GMT -8:00]
.
AV: AVG Anti-Virus Free Edition 2011 *Enabled/Updated* {5A2746B1-DEE9-F85A-FBCD-ADB11639C5F0}
SP: AVG Anti-Virus Free Edition 2011 *Enabled/Updated* {E146A755-F8D3-F7D4-C17D-96C36DBE8F4D}
SP: Windows Defender *Disabled/Outdated* {D68DDC3A-831F-4fae-9E44-DA132C1ACF46}
.
============== Running Processes ===============
.
C:\PROGRA~1\AVG\AVG10\avgchsvx.exe
C:\Windows\system32\wininit.exe
C:\Windows\system32\lsm.exe
C:\Windows\system32\svchost.exe -k DcomLaunch
C:\Windows\system32\nvvsvc.exe
C:\Windows\system32\svchost.exe -k RPCSS
C:\Windows\system32\atiesrxx.exe
C:\Windows\System32\svchost.exe -k LocalServiceNetworkRestricted
C:\Windows\System32\svchost.exe -k LocalSystemNetworkRestricted
C:\Windows\system32\svchost.exe -k netsvcs
C:\Windows\system32\svchost.exe -k LocalService
C:\Windows\system32\svchost.exe -k NetworkService
C:\Windows\system32\atieclxx.exe
C:\Program Files\NVIDIA Corporation\Display\NvXDSync.exe
C:\Windows\system32\nvvsvc.exe
C:\Windows\System32\spoolsv.exe
C:\Windows\system32\svchost.exe -k LocalServiceNoNetwork
C:\Program Files\Application Updater\ApplicationUpdater.exe
C:\Program Files\AVG\AVG10\avgwdsvc.exe
C:\Program Files\Bonjour\mDNSResponder.exe
C:\ProgramData\EPSON\EPW!3 SSRP\E_S30RP1.EXE
C:\Windows\system32\svchost.exe -k LocalServiceAndNoImpersonation
C:\Program Files\Common Files\Microsoft Shared\VS7DEBUG\mdm.exe
C:\Windows\system32\PnkBstrA.exe
C:\Program Files\Microsoft\Search Enhancement Pack\SeaPort\SeaPort.exe
C:\Program Files\NVIDIA Corporation\3D Vision\nvSCPAPISvr.exe
C:\Windows\system32\svchost.exe -k imgsvc
C:\Program Files\TeamViewer\Version5\TeamViewer_Service.exe
C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSVC.EXE
C:\Program Files\Common Files\Microsoft Shared\Windows Live\WLIDSvcM.exe
C:\Program Files\AVG\AVG10\Identity Protection\Agent\Bin\AVGIDSAgent.exe
C:\Program Files\AVG\AVG10\avgnsx.exe
C:\Windows\system32\taskhost.exe
C:\Windows\system32\svchost.exe -k NetworkServiceNetworkRestricted
C:\Windows\system32\WUDFHost.exe
C:\Windows\system32\Dwm.exe
C:\Windows\Explorer.EXE
C:\Program Files\Adobe\Acrobat 8.0\Acrobat\acrotray.exe
C:\Windows\System32\rundll32.exe
C:\Program Files\AVG\AVG10\avgtray.exe
C:\Program Files\Winamp\winampa.exe
C:\Program Files\Common Files\Spigot\Search Settings\SearchSettings.exe
C:\Program Files\Common Files\Java\Java Update\jusched.exe
C:\Program Files\Windows Sidebar\sidebar.exe
C:\Windows\System32\spool\drivers\w32x86\3\E_FATIBPA.EXE
C:\Program Files\Logitech\SetPoint\SetPoint.exe
C:\Program Files\Common Files\Logishrd\KHAL2\KHALMNPR.EXE
C:\Program Files\AVG\AVG10\Identity Protection\agent\bin\avgidsmonitor.exe
C:\Windows\system32\conhost.exe
C:\Program Files\Common Files\Macrovision Shared\FLEXnet Publisher\FNPLicensingService.exe
C:\Windows\system32\SearchIndexer.exe
C:\Program Files\Windows Media Player\wmpnetwk.exe
C:\Windows\System32\svchost.exe -k LocalServicePeerNet
C:\Windows\system32\DllHost.exe
C:\PROGRA~1\AVG\AVG10\avgrsx.exe
C:\Program Files\AVG\AVG10\avgcsrvx.exe
C:\Users\Erik\AppData\Local\Google\Chrome\Application\chrome.exe
C:\Users\Erik\AppData\Local\Google\Chrome\Application\chrome.exe
C:\Users\Erik\AppData\Local\Google\Chrome\Application\chrome.exe
C:\Windows\system32\taskhost.exe
C:\Windows\system32\DllHost.exe
C:\Windows\system32\DllHost.exe
C:\Users\Erik\Downloads\dds.scr
C:\Windows\system32\conhost.exe
C:\Windows\system32\wbem\wmiprvse.exe
.
============== Pseudo HJT Report ===============
.
uStart Page = hxxp://www.google.com/
uSearch Bar = Preserve
uInternet Settings,ProxyOverride = *.local
uURLSearchHooks: IObit Toolbar: {0bda0769-fd72-49f4-9266-e1fb004f4d8f} - c:\program files\iobit toolbar\ie\4.3\iobitToolbarIE.dll
uURLSearchHooks: H - No File
mURLSearchHooks: XfireXO Toolbar: {5e5ab302-7f65-44cd-8211-c1d4caaccea3} - c:\program files\xfirexo\tbXfir.dll
mURLSearchHooks: AVG Security Toolbar BHO: {a3bc75a2-1f87-4686-aa43-5347d756017c} - c:\program files\avg\avg10\toolbar\IEToolbar.dll
BHO: Adobe PDF Reader Link Helper: {06849e9f-c8d7-4d59-b87d-784b7d6be0b3} - c:\program files\common files\adobe\acrobat\activex\AcroIEHelper.dll
BHO: ContributeBHO Class: {074c1dc5-9320-4a9a-947d-c042949c6216} - c:\program files\adobe\/Adobe Contribute CS3/contributeieplugin.dll
BHO: IObit Toolbar: {0bda0769-fd72-49f4-9266-e1fb004f4d8f} - c:\program files\iobit toolbar\ie\4.3\iobitToolbarIE.dll
BHO: Conduit Engine: {30f9b915-b755-4826-820b-08fba6bd249d} - c:\program files\conduitengine\ConduitEngine.dll
BHO: AVG Safe Search: {3ca2f312-6f6e-4b53-a66e-4e65e497c8c0} - c:\program files\avg\avg10\avgssie.dll
BHO: Updater For ooVoo Toolbar: {442ae524-eba5-4b17-82f3-888d68bc999a} - c:\program files\oovootb\auxi\oovooAu.dll
BHO: XfireXO Toolbar: {5e5ab302-7f65-44cd-8211-c1d4caaccea3} - c:\program files\xfirexo\tbXfir.dll
BHO: Search Helper: {6ebf7485-159f-4bff-a14f-b9e3aac4465b} - c:\program files\microsoft\search enhancement pack\search helper\SEPsearchhelperie.dll
BHO: Windows Live ID Sign-in Helper: {9030d464-4c02-4abf-8ecc-5164760863c6} - c:\program files\common files\microsoft shared\windows live\WindowsLiveLogin.dll
BHO: Windows Live Messenger Companion Helper: {9fdde16b-836f-4806-ab1f-1455cbeff289} - c:\program files\windows live\companion\companioncore.dll
BHO: ooVoo Toolbar: {a1fb2f9a-d35e-11dd-8935-e46a56d89593} - c:\program files\oovootb\oovoodx.dll
BHO: AVG Security Toolbar BHO: {a3bc75a2-1f87-4686-aa43-5347d756017c} - c:\program files\avg\avg10\toolbar\IEToolbar.dll
BHO: Adobe PDF Conversion Toolbar Helper: {ae7cd045-e861-484f-8273-0445ee161910} - c:\program files\adobe\acrobat 8.0\acrobat\AcroIEFavClient.dll
BHO: Skype add-on for Internet Explorer: {ae805869-2e5c-4ed4-8f7b-f1f7851a4497} - c:\program files\skype\toolbars\internet explorer\skypeieplugin.dll
BHO: Bing Bar BHO: {d2ce3e00-f94a-4740-988e-03dc2f38c34f} - c:\program files\msn toolbar\platform\6.3.2322.0\npwinext.dll
BHO: Java(tm) Plug-In 2 SSV Helper: {dbc80044-a445-435b-bc74-9c25c1c588a9} - c:\program files\java\jre6\bin\jp2ssv.dll
TB: AVG Security Toolbar: {ccc7a320-b3ca-4199-b1a6-9f516dd69829} - c:\program files\avg\avg10\toolbar\IEToolbar.dll
TB: XfireXO Toolbar: {5e5ab302-7f65-44cd-8211-c1d4caaccea3} - c:\program files\xfirexo\tbXfir.dll
TB: Adobe PDF: {47833539-d0c5-4125-9fa8-0819e2eaac93} - c:\program files\adobe\acrobat 8.0\acrobat\AcroIEFavClient.dll
TB: Contribute Toolbar: {517bdde4-e3a7-4570-b21e-2b52b6139fc7} - c:\program files\adobe\/Adobe Contribute CS3/contributeieplugin.dll
TB: ooVoo Toolbar: {a1fb2f9a-d35e-11dd-8935-e46a56d89593} - c:\program files\oovootb\oovoodx.dll
TB: Conduit Engine: {30f9b915-b755-4826-820b-08fba6bd249d} - c:\program files\conduitengine\ConduitEngine.dll
TB: @c:\program files\msn toolbar\platform\6.3.2322.0\npwinext.dll,-100: {8dcb7100-df86-4384-8842-8fa844297b3f} - c:\program files\msn toolbar\platform\6.3.2322.0\npwinext.dll
TB: IObit Toolbar: {0bda0769-fd72-49f4-9266-e1fb004f4d8f} - c:\program files\iobit toolbar\ie\4.3\iobitToolbarIE.dll
EB: Adobe PDF: {182ec0be-5110-49c8-a062-beb1d02a220b} - c:\program files\adobe\acrobat 8.0\acrobat\AcroIEFavClient.dll
uRun: [Google Update] "c:\users\erik\appdata\local\google\update\GoogleUpdate.exe" /c
uRun: [Sidebar] c:\program files\windows sidebar\sidebar.exe /autoRun
uRun: [EPSON Stylus Photo RX580 Series] c:\windows\system32\spool\drivers\w32x86\3\e_fatibpa.exe /fu "c:\windows\temp\E_S8D68.tmp" /EF "HKCU"
mRun: [Acrobat Assistant 8.0] "c:\program files\adobe\acrobat 8.0\acrobat\Acrotray.exe"
mRun: [Kernel and Hardware Abstraction Layer] KHALMNPR.EXE
mRun: [NetFxUpdate_v1.1.4322] "c:\windows\microsoft.net\framework\v1.1.4322\netfxupdate.exe" 1 v1.1.4322 GAC + NI NID
mRun: [VF0060 STISvc] RunDLL32.exe V0060Pin.dll,RunDLL32EP 513
mRun: [AVG_TRAY] c:\program files\avg\avg10\avgtray.exe
mRun: [WinampAgent] "c:\program files\winamp\winampa.exe"
mRun: [<NO NAME>]
mRun: [SearchSettings] "c:\program files\common files\spigot\search settings\SearchSettings.exe"
mRun: [SunJavaUpdateSched] "c:\program files\common files\java\java update\jusched.exe"
StartupFolder: c:\progra~2\micros~1\windows\startm~1\programs\startup\logite~1.lnk - c:\program files\logitech\setpoint\SetPoint.exe
mPolicies-system: ConsentPromptBehaviorAdmin = 5 (0x5)
mPolicies-system: ConsentPromptBehaviorUser = 3 (0x3)
mPolicies-system: EnableUIADesktopToggle = 0 (0x0)
IE: {0000036B-C524-4050-81A0-243669A86B9F} - {B63DBA5F-523F-4B9C-A43D-65DF1977EAD3} - c:\program files\windows live\companion\companioncore.dll
IE: {219C3416-8CB2-491a-A3C7-D9FCDDC9D600} - {5F7B1267-94A9-47F5-98DB-E99415F33AEC} - c:\program files\windows live\writer\WriterBrowserExtension.dll
IE: {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - {898EA8C8-E7FF-479B-8935-AEC46303B9E5} - c:\program files\skype\toolbars\internet explorer\skypeieplugin.dll
IE: {92780B25-18CC-41C8-B9BE-3C9C571A8263} - {FF059E31-CC5A-4E2E-BF3B-96E929D65503} - c:\progra~1\mif5ba~1\office12\REFIEBAR.DLL
Trusted Zone: aol.com\free
DPF: {8AD9C840-044E-11D1-B3E9-00805F499D93} - hxxp://java.sun.com/update/1.6.0/jinsta ... s-i586.cab
DPF: {CAFEEFAC-0016-0000-0024-ABCDEFFEDCBA} - hxxp://java.sun.com/update/1.6.0/jinsta ... s-i586.cab
DPF: {CAFEEFAC-FFFF-FFFF-FFFF-ABCDEFFEDCBA} - hxxp://java.sun.com/update/1.6.0/jinsta ... s-i586.cab
DPF: {D27CDB6E-AE6D-11CF-96B8-444553540000} - hxxp://fpdownload2.macromedia.com/get/s ... wflash.cab
Handler: avgsecuritytoolbar - {F2DDE6B2-9684-4A55-86D4-E255E237B77C} - c:\program files\avg\avg10\toolbar\IEToolbar.dll
Handler: linkscanner - {F274614C-63F8-47D5-A4D1-FBDDE494F8D1} - c:\program files\avg\avg10\avgpp.dll
Handler: skype-ie-addon-data - {91774881-D725-4E58-B298-07617B9B86A8} - c:\program files\skype\toolbars\internet explorer\skypeieplugin.dll
Handler: skype4com - {FFC8B962-9B40-4DFF-9458-1830C7DD7F5D} - c:\progra~1\common~1\skype\SKYPE4~1.DLL
Handler: wlpg - {E43EF6CD-A37A-4A9B-9E6F-83F89B8E6324} - c:\program files\windows live\photo gallery\AlbumDownloadProtocolHandler.dll
Notify: LBTWlgn - c:\program files\common files\logishrd\bluetooth\LBTWlgn.dll
.
================= FIREFOX ===================
.
FF - ProfilePath - c:\users\erik\appdata\roaming\mozilla\firefox\profiles\hacx6vcb.default\
FF - prefs.js: browser.search.selectedEngine - Yahoo
FF - prefs.js: browser.startup.homepage - hxxp://google.com
FF - prefs.js: keyword.URL - hxxp://search.yahoo.com/search?fr=green ... =382950&p=
FF - prefs.js: browser.search.selectedEngine - Yahoo
FF - prefs.js: keyword.URL - hxxp://search.yahoo.com/search?fr=green ... =382950&p=
FF - component: c:\program files\avg\avg10\firefox\components\avgssff.dll
FF - component: c:\program files\common files\spigot\wtxpcom\components\WidgiToolbarFF.dll
FF - plugin: c:\program files\java\jre6\bin\new_plugin\npdeployJava1.dll
FF - plugin: c:\program files\nvidia corporation\3d vision\npnv3dv.dll
FF - plugin: c:\program files\nvidia corporation\3d vision\npnv3dvstreaming.dll
FF - plugin: c:\program files\windows live\photo gallery\NPWLPG.dll
FF - plugin: c:\users\erik\appdata\local\google\update\1.2.183.39\npGoogleOneClick8.dll
FF - plugin: c:\users\erik\appdata\local\yahoo!\browserplus\2.9.8\plugins\npybrowserplus_2.9.8.dll
FF - plugin: c:\users\erik\appdata\roaming\mozilla\firefox\profiles\hacx6vcb.default\extensions\battlefieldplay4free@ea.com\platform\winnt_x86-msvc\plugins\npBP4FUpdater.dll
FF - Ext: Default: {972ce4c6-7e08-4474-a285-3208198ce6fd} - c:\program files\mozilla firefox\extensions\{972ce4c6-7e08-4474-a285-3208198ce6fd}
FF - Ext: Java Console: {CAFEEFAC-0016-0000-0023-ABCDEFFEDCBA} - c:\program files\mozilla firefox\extensions\{CAFEEFAC-0016-0000-0023-ABCDEFFEDCBA}
FF - Ext: AVG Safe Search: {3f963a5b-e555-4543-90e2-c3908898db71} - c:\program files\avg\avg10\Firefox
FF - Ext: Battlefield Play4Free: battlefieldplay4free@ea.com - %profile%\extensions\battlefieldplay4free@ea.com
.
============= SERVICES / DRIVERS ===============
.
R0 AVGIDSEH;AVGIDSEH;c:\windows\system32\drivers\AVGIDSEH.sys [2010-9-13 25680]
R0 Avgrkx86;AVG Anti-Rootkit Driver;c:\windows\system32\drivers\avgrkx86.sys [2010-9-7 26064]
R1 Avgldx86;AVG AVI Loader Driver;c:\windows\system32\drivers\avgldx86.sys [2010-12-8 251728]
R1 Avgmfx86;AVG Mini-Filter Resident Anti-Virus Shield;c:\windows\system32\drivers\avgmfx86.sys [2010-9-7 34384]
R1 Avgtdix;AVG TDI Driver;c:\windows\system32\drivers\avgtdix.sys [2010-11-12 299984]
R2 AMD External Events Utility;AMD External Events Utility;c:\windows\system32\atiesrxx.exe [2009-8-18 176128]
R2 Application Updater;Application Updater;c:\program files\application updater\ApplicationUpdater.exe [2011-1-28 387072]
R2 AVGIDSAgent;AVGIDSAgent;c:\program files\avg\avg10\identity protection\agent\bin\AVGIDSAgent.exe [2011-1-6 6128720]
R2 avgwd;AVG WatchDog;c:\program files\avg\avg10\avgwdsvc.exe [2010-10-22 265400]
R2 Stereo Service;NVIDIA Stereoscopic 3D Driver Service;c:\program files\nvidia corporation\3d vision\nvSCPAPISvr.exe [2010-10-16 369256]
R2 TeamViewer5;TeamViewer 5;c:\program files\teamviewer\version5\TeamViewer_Service.exe [2010-7-6 173352]
R3 AVGIDSDriver;AVGIDSDriver;c:\windows\system32\drivers\AVGIDSDriver.sys [2010-8-19 123472]
R3 AVGIDSFilter;AVGIDSFilter;c:\windows\system32\drivers\AVGIDSFilter.sys [2010-8-19 30288]
R3 AVGIDSShim;AVGIDSShim;c:\windows\system32\drivers\AVGIDSShim.sys [2010-8-19 21072]
R3 L1C;NDIS Miniport Driver for Atheros AR813x/AR815x PCI-E Ethernet Controller;c:\windows\system32\drivers\L1C62x86.sys [2009-11-13 58368]
S2 clr_optimization_v4.0.30319_32;Microsoft .NET Framework NGEN v4.0.30319_X86;c:\windows\microsoft.net\framework\v4.0.30319\mscorsvw.exe [2010-3-18 130384]
S3 AVG Security Toolbar Service;AVG Security Toolbar Service;c:\program files\avg\avg10\toolbar\ToolbarBroker.exe [2010-10-27 517448]
S3 b57nd60x;Broadcom NetXtreme Gigabit Ethernet - NDIS 6.0;c:\windows\system32\drivers\b57nd60x.sys [2009-7-13 229888]
S3 fssfltr;fssfltr;c:\windows\system32\drivers\fssfltr.sys [2010-10-21 39272]
S3 fsssvc;Windows Live Family Safety Service;c:\program files\windows live\family safety\fsssvc.exe [2010-9-22 1493352]
S3 StorSvc;Storage Service;c:\windows\system32\svchost.exe -k LocalSystemNetworkRestricted [2009-7-13 20992]
S3 V0060VID;Creative WebCam Live! Ultra;c:\windows\system32\drivers\V0060Vid.sys [2010-10-1 196409]
S3 WatAdminSvc;Windows Activation Technologies Service;c:\windows\system32\wat\WatAdminSvc.exe [2010-5-22 1343400]
S4 wlcrasvc;Windows Live Mesh remote connections service;c:\program files\windows live\mesh\wlcrasvc.exe [2010-9-22 51040]
.
=============== Created Last 30 ================
.
2011-03-05 04:49:20 -------- d-----w- c:\program files\IObit Toolbar
2011-03-05 04:49:20 -------- d-----w- c:\program files\Application Updater
2011-03-04 15:16:31 -------- d-----w- c:\users\erik\appdata\local\{97B5ED05-9358-45B1-B367-00A3F3DA8484}
2011-03-02 16:16:53 -------- d-----w- c:\users\erik\appdata\local\{3973821A-4368-46AB-879B-A25C911EB86C}
2011-03-01 18:47:50 -------- d-----w- c:\users\erik\appdata\local\{A2CB3EC2-8720-4DDD-BF14-A52337A45F34}
2011-02-26 01:19:32 41872 ----a-w- c:\windows\system32\xfcodec.dll
2011-02-25 22:31:50 -------- d-----w- c:\program files\Epson Software
2011-02-25 22:27:46 -------- d-----w- c:\progra~2\EPSON
2011-02-25 22:22:42 212480 ----a-w- c:\windows\PCDLIB32.DLL
2011-02-25 22:14:52 -------- d-----w- c:\program files\EPSON Print CD
2011-02-25 22:14:45 696320 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\iKernel.dll
2011-02-25 22:14:45 57344 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\ctor.dll
2011-02-25 22:14:45 5632 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\DotNetInstaller.exe
2011-02-25 22:14:45 282756 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\setup.dll
2011-02-25 22:14:45 237568 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\iscript.dll
2011-02-25 22:14:45 163972 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\iGdi.dll
2011-02-25 22:14:45 155648 ----a-w- c:\program files\common files\installshield\professional\runtime\0701\intel32\iuser.dll
2011-02-25 22:10:40 80024 ----a-w- c:\windows\system32\PICSDK.dll
2011-02-25 22:10:40 51360 ----a-w- c:\windows\system32\EpPicPrt.dll
2011-02-25 22:10:40 51360 ----a-w- c:\windows\system32\EpPicMgr.dll
2011-02-25 22:10:40 501912 ----a-w- c:\windows\system32\PICSDK2.dll
2011-02-25 22:10:40 108704 ----a-w- c:\windows\system32\PICEntry.dll
2011-02-25 22:09:01 -------- d-----w- c:\program files\epson
2011-02-25 22:09:00 61952 ----a-w- c:\windows\system32\escwiad.dll
2011-02-25 21:52:39 -------- d-----w- c:\progra~2\SSScanAppDataDir
2011-02-25 21:52:32 -------- d-----w- c:\progra~2\MSScanAppDataDir
2011-02-24 00:49:47 276992 ----a-w- c:\windows\system32\wcncsvc.dll
2011-02-23 15:09:38 442880 ----a-w- c:\windows\system32\XpsPrint.dll
2011-02-23 15:09:38 288256 ----a-w- c:\windows\system32\XpsGdiConverter.dll
2011-02-17 03:19:47 -------- d-----w- c:\users\erik\appdata\local\{643409F1-35F6-4A79-AF55-4619BA74ACD2}
2011-02-12 18:07:06 -------- d-----w- c:\users\erik\appdata\local\{A5A0FA6A-460E-4AE8-B085-6629779AF69D}
2011-02-12 17:07:19 472808 ----a-w- c:\program files\mozilla firefox\plugins\npdeployJava1.dll
2011-02-10 22:54:40 -------- d-----w- c:\users\erik\appdata\local\Aptana Studio 2.0
2011-02-08 16:38:10 -------- d-----w- c:\users\erik\appdata\local\{3D965CD1-D675-4B8F-BF48-C6EB6A7712D1}
.
==================== Find3M ====================
.
2011-02-27 22:33:35 234536 ----a-w- c:\windows\system32\PnkBstrB.xtr
2011-02-27 22:33:35 234536 ----a-w- c:\windows\system32\PnkBstrB.exe
2011-02-27 22:33:28 215128 ----a-w- c:\windows\system32\PnkBstrB.ex0
2011-02-03 05:40:23 472808 ----a-w- c:\windows\system32\deployJava1.dll
2011-01-07 07:27:11 34304 ----a-w- c:\windows\system32\atmlib.dll
2011-01-07 05:33:11 294400 ----a-w- c:\windows\system32\atmfd.dll
2011-01-05 05:37:33 428032 ----a-w- c:\windows\system32\vbscript.dll
2011-01-05 03:37:38 2329088 ----a-w- c:\windows\system32\win32k.sys
2011-01-04 21:15:02 75136 ----a-w- c:\windows\system32\PnkBstrA.exe
2010-12-21 05:38:24 73728 ----a-w- c:\windows\system32\wscsvc.dll
2010-12-21 05:38:24 51200 ----a-w- c:\windows\system32\wscapi.dll
2010-12-21 05:38:22 981504 ----a-w- c:\windows\system32\wininet.dll
2010-12-21 05:38:22 350720 ----a-w- c:\windows\system32\winhttp.dll
2010-12-21 05:38:21 204800 ----a-w- c:\windows\system32\WebClnt.dll
2010-12-21 05:38:19 204288 ----a-w- c:\windows\system32\upnp.dll
2010-12-21 05:38:16 14336 ----a-w- c:\windows\system32\slwga.dll
2010-12-21 05:36:17 1389568 ----a-w- c:\windows\system32\msxml6.dll
2010-12-21 05:36:16 1236992 ----a-w- c:\windows\system32\msxml3.dll
2010-12-21 05:34:12 80384 ----a-w- c:\windows\system32\davclnt.dll
2010-12-18 05:29:40 44544 ----a-w- c:\windows\system32\licmgr10.dll
2010-12-18 05:29:31 541184 ----a-w- c:\windows\system32\kerberos.dll
2010-12-18 04:20:55 386048 ----a-w- c:\windows\system32\html.iec
2010-12-18 03:47:59 1638912 ----a-w- c:\windows\system32\mshtml.tlb
2010-12-17 05:21:06 138056 ----a-w- c:\users\erik\appdata\roaming\PnkBstrK.sys
.
============= FINISH: 14:13:25.72 ===============



.
UNLESS SPECIFICALLY INSTRUCTED, DO NOT POST THIS LOG.
IF REQUESTED, ZIP IT UP & ATTACH IT
.
DDS (Ver_11-03-05.01)
.
Microsoft Windows 7 Professional
Boot Device: \Device\HarddiskVolume1
Install Date: 5/21/2010 8:25:06 PM
System Uptime: 3/5/2011 10:00:43 AM (4 hours ago)
.
Motherboard: ASUSTeK Computer INC. | | M4A78LT-M-LE
Processor: AMD Athlon(tm) II X4 630 Processor | AM3 | 2800/200mhz
.
==== Disk Partitions =========================
.
C: is FIXED (NTFS) - 466 GiB total, 357.336 GiB free.
E: is Removable
F: is Removable
G: is Removable
H: is Removable
I: is FIXED (NTFS) - 466 GiB total, 441.212 GiB free.
J: is Removable
.
==== Disabled Device Manager Items =============
.
Class GUID: {4d36e965-e325-11ce-bfc1-08002be10318}
Description: CD-ROM Drive
Device ID: IDE\CDROMOPTIARC_DVD_RW_AD-7241S_________________1.03____\5&F437AB5&0&0.1.0
Manufacturer: (Standard CD-ROM drives)
Name: Optiarc DVD RW AD-7241S ATA Device
PNP Device ID: IDE\CDROMOPTIARC_DVD_RW_AD-7241S_________________1.03____\5&F437AB5&0&0.1.0
Service: cdrom
.
==== System Restore Points ===================
.
RP129: 2/23/2011 4:49:27 PM - Windows Update
RP131: 2/25/2011 2:09:13 PM - Installed EPSON Stylus Photo RX580 Scanner Driver Update
RP133: 2/25/2011 2:10:32 PM - Installed EPSON EasyPrintModule
RP135: 2/25/2011 2:14:46 PM - Installed EPSON Print CD
RP137: 2/25/2011 2:22:34 PM - Installed PhotoImpression
RP139: 2/25/2011 2:31:11 PM - Installed Epson CreativeZone
RP141: 2/25/2011 2:31:50 PM - Installed Epson Print CD
RP142: 3/4/2011 8:50:19 PM - Installed Java(TM) 6 Update 24
RP143: 3/4/2011 8:51:34 PM - Installed Java Runtime Environment
RP144: 3/5/2011 8:31:40 AM - Windows Modules Installer
.
==== Installed Programs ======================
.
Add or Remove Adobe Creative Suite 3 Master Collection
Adobe Acrobat 8 Professional
Adobe After Effects CS3
Adobe After Effects CS3 Presets
Adobe Anchor Service CS3
Adobe Asset Services CS3
Adobe Bridge CS3
Adobe Bridge Start Meeting
Adobe BridgeTalk Plugin CS3
Adobe Camera Raw 4.0
Adobe CMaps
Adobe Color - Photoshop Specific
Adobe Color Common Settings
Adobe Color EU Extra Settings
Adobe Color JA Extra Settings
Adobe Color NA Recommended Settings
Adobe Contribute CS3
Adobe Creative Suite 3 Master Collection
Adobe Default Language CS3
Adobe Device Central CS3
Adobe Dreamweaver CS3
Adobe Encore CS3
Adobe Encore CS3 Codecs
Adobe ExtendScript Toolkit 2
Adobe Extension Manager CS3
Adobe Fireworks CS3
Adobe Flash CS3
Adobe Flash Player 10 ActiveX
Adobe Flash Player 10 Plugin
Adobe Flash Video Encoder
Adobe Fonts All
Adobe Help Viewer CS3
Adobe Illustrator CS3
Adobe InDesign CS3
Adobe InDesign CS3 Icon Handler
Adobe Linguistics CS3
Adobe MotionPicture Color Files
Adobe PDF Library Files
Adobe Photoshop CS3
Adobe Premiere Pro CS3
Adobe Premiere Pro CS3 Functional Content
Adobe Premiere Pro CS3 Third Party Content
Adobe Setup
Adobe SING CS3
Adobe Soundbooth CS3
Adobe Soundbooth CS3 Codecs
Adobe Stock Photos CS3
Adobe Type Support
Adobe Update Manager CS3
Adobe Version Cue CS3 Client
Adobe Version Cue CS3 Server
Adobe Video Profiles
Adobe WAS CS3
Adobe WinSoft Linguistics Plugin
Adobe XMP DVA Panels CS3
Adobe XMP Panels CS3
AHV content for Acrobat and Flash
Alien Swarm
Allied Intent Xtended 2.0
Aptana Studio 2.0
ArcSoft PhotoImpression 5
AVG 2011
AVG PC Tuneup 2011
Battlefield 2(TM)
Battlefield Play4Free
Battlefield: Bad Company 2
Bing Bar
Bing Bar Platform
Call of Duty(R) 4 - Modern Warfare(TM)
Call of Duty(R) 4 - Modern Warfare(TM) 1.7 Patch
Call of Duty: Black Ops
Call of Duty: Black Ops - Multiplayer
CDDRV_Installer
Conduit Engine
Creative WebCam Center
Creative WebCam Live! Ultra Driver (1.01.03.0127)
Creative WebCam Live! Ultra User's Guide (English)
D3DX10
Epson Print CD
EPSON Printer Software
EPSON Scan
EPSON Stylus Photo RX580 Scanner Driver Update
EPSON Stylus Photo RX580 User's Guide
erLT
FileZilla Client 3.3.5.1
FreeApps
GameSpy Arcade
Get Yahoo! Messenger
Google Chrome
GTactix
HyperLobby client
IL-2 Sturmovik: 1946
Internet TV for Windows Media Center
IObit Toolbar v4.3
Java Auto Updater
Java(TM) 6 Update 24
Junk Mail filter update
KhalInstallWrapper
Logitech SetPoint
Mesh Runtime
Messenger Companion
Microsoft .NET Framework 1.1
Microsoft .NET Framework 4 Client Profile
Microsoft Application Error Reporting
Microsoft Office 2007 Service Pack 2 (SP2)
Microsoft Office Access MUI (English) 2007
Microsoft Office Access Setup Metadata MUI (English) 2007
Microsoft Office Excel MUI (English) 2007
Microsoft Office InfoPath MUI (English) 2007
Microsoft Office Outlook Connector
Microsoft Office Outlook MUI (English) 2007
Microsoft Office PowerPoint MUI (English) 2007
Microsoft Office Professional Plus 2007
Microsoft Office Proof (English) 2007
Microsoft Office Proof (French) 2007
Microsoft Office Proof (Spanish) 2007
Microsoft Office Proofing (English) 2007
Microsoft Office Proofing Tools 2007 Service Pack 2 (SP2)
Microsoft Office Publisher MUI (English) 2007
Microsoft Office Shared MUI (English) 2007
Microsoft Office Shared Setup Metadata MUI (English) 2007
Microsoft Office Word MUI (English) 2007
Microsoft Search Enhancement Pack
Microsoft Silverlight
Microsoft SQL Server 2005 Compact Edition [ENU]
Microsoft Visual C++ 2005 Redistributable
Microsoft Visual C++ 2008 ATL Update kb973924 - x86 9.0.30729.4148
Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.17
Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.4148
Mozilla Firefox (3.6.13)
MSVCRT
NVIDIA 3D Vision Driver 260.99
NVIDIA Control Panel 260.99
NVIDIA Graphics Driver 260.99
NVIDIA Install Application
NVIDIA PhysX
NVIDIA PhysX System Software 9.10.0514
NVIDIA Stereoscopic 3D Driver
OGA Notifier 2.0.0048.0
ooVoo
ooVoo Toolbar (Remove Toolbar Only)
PDF Settings
PunkBuster Services
PVSonyDll
Security Update for 2007 Microsoft Office System (KB2288621)
Security Update for 2007 Microsoft Office System (KB2288931)
Security Update for 2007 Microsoft Office System (KB2289158)
Security Update for 2007 Microsoft Office System (KB2344875)
Security Update for 2007 Microsoft Office System (KB2345043)
Security Update for 2007 Microsoft Office System (KB969559)
Security Update for 2007 Microsoft Office System (KB976321)
Security Update for CAPICOM (KB931906)
Security Update for Microsoft Office Access 2007 (KB979440)
Security Update for Microsoft Office Excel 2007 (KB2345035)
Security Update for Microsoft Office InfoPath 2007 (KB979441)
Security Update for Microsoft Office PowerPoint 2007 (KB982158)
Security Update for Microsoft Office PowerPoint Viewer (KB2413381)
Security Update for Microsoft Office Publisher 2007 (KB2284697)
Security Update for Microsoft Office system 2007 (972581)
Security Update for Microsoft Office system 2007 (KB974234)
Security Update for Microsoft Office Visio Viewer 2007 (KB973709)
Security Update for Microsoft Office Word 2007 (KB2344993)
Skype Toolbars
Skype™ 4.2
Smart Defrag
Steam
Stellarium 0.10.5
TeamSpeak 3 Client
TeamViewer 5
Update for 2007 Microsoft Office System (KB967642)
Update for Microsoft Office 2007 Help for Common Features (KB963673)
Update for Microsoft Office Access 2007 Help (KB963663)
Update for Microsoft Office Excel 2007 Help (KB963678)
Update for Microsoft Office Infopath 2007 Help (KB963662)
Update for Microsoft Office Outlook 2007 (KB2412171)
Update for Microsoft Office Outlook 2007 Help (KB963677)
Update for Microsoft Office Powerpoint 2007 Help (KB963669)
Update for Microsoft Office Publisher 2007 Help (KB963667)
Update for Microsoft Office Script Editor Help (KB963671)
Update for Microsoft Office Word 2007 Help (KB963665)
Update for Outlook 2007 Junk Email Filter (KB2492475)
Ventrilo Client
VLC media player 1.1.5
Winamp
Winamp Detector Plug-in
Windows Live Communications Platform
Windows Live Essentials
Windows Live Family Safety
Windows Live ID Sign-in Assistant
Windows Live Installer
Windows Live Mail
Windows Live Mesh
Windows Live Mesh ActiveX Control for Remote Connections
Windows Live Messenger
Windows Live Messenger Companion Core
Windows Live MIME IFilter
Windows Live Movie Maker
Windows Live Photo Common
Windows Live Photo Gallery
Windows Live PIMT Platform
Windows Live Remote Client
Windows Live Remote Client Resources
Windows Live Remote Service
Windows Live Remote Service Resources
Windows Live SOXE
Windows Live SOXE Definitions
Windows Live Sync
Windows Live UX Platform
Windows Live UX Platform Language Pack
Windows Live Writer
Windows Live Writer Resources
Windows Media Center Add-in for Flash
Windows Media Player Firefox Plugin
World of Tanks Closed Beta v.0.5.4.1
Xfire (remove only)
XfireXO Toolbar
Yahoo! BrowserPlus 2.9.8
.
==== Event Viewer Messages From Past Week ========
.
3/5/2011 10:01:07 AM, Error: volmgr [46] - Crash dump initialization failed!
3/5/2011 1:59:29 PM, Error: Disk [11] - The driver detected a controller error on \Device\Harddisk1\DR1.
2/26/2011 4:18:34 PM, Error: Service Control Manager [7009] - A timeout was reached (30000 milliseconds) while waiting for the Steam Client Service service to connect.
2/26/2011 4:18:34 PM, Error: Service Control Manager [7000] - The Steam Client Service service failed to start due to the following error: The service did not respond to the start or control request in a timely fashion.
.
==== End Of File ===========================
ejack1
Active Member
 
Posts: 11
Joined: July 13th, 2008, 6:27 pm

Re: I Got Spigot on Win 7

Unread postby Carolyn » March 6th, 2011, 11:36 am

Hello Erik,

Punkbuster warning

I see you have Punkbuster installed. (read the section on Published features) This is spyware. Punkbuster can take control over various aspects of your computer, and some gaming tools not unlike Punkbuster also hinder their removals. By the definition we handle here, Punkbuster is actual spyware. Therefore, I now ask you to decide the following:
  • Either we try to leave Punkbuster alone but there is no guarantee a spyware component doesn't 'accidentally' get taken out; so Punkbuster might break. This will, of course, also break your ability to play games using Punkbuster enabled servers.
  • Or we can just remove Punkbuster. You can reinstall it afterwards if you wish, but please keep in mind that It is spyware.
  • Another option is to not clean this computer at all. This ensures Punkbuster will continue to function.
Please let me know what you would like to do.

=======================

If you want to continue with the cleaning process, please do the following:

Uninstall Programs
  • Go to start > control panel > programs and features.
  • Right click on each instance of:

    Call of Duty(R) 4 - Modern Warfare(TM)
    Call of Duty(R) 4 - Modern Warfare(TM) 1.7 Patch
    Call of Duty: Black Ops
    Call of Duty: Black Ops - Multiplayer
    IObit Toolbar v4.3
    Punkbuster <---- Optional removal


  • Click Uninstall & then follow the prompts to remove them.

=======================

Create a System Restore Point
  1. Right-click on Computer ... select Properties.
  2. In the left pane under Tasks ... click System protection.
    If UAC prompts for an administrator password or approval, type the password or give your "permission to continue".
  3. Select System Protection ...then choose Create.
  4. In the System Restore dialog box, type a description for the restore point ... click Create, again.
    A window will pop up with "The Restore Point was created successfully" confirmation message.
  5. Click OK ...then close the System Restore dialog.
    Now you have a clean restore point to use if you need to restore your system.

=======================

Note: If you are using Windows Vista or Windows 7, please run all scans/tools by right-clicking on its icon and selecting 'Run as administrator' .

Please download Malwarebytes' Anti-Malware and save it to a convenient location.
  1. Double click on mbam-setup.exe to install it.
  2. Before clicking the Finish button, make sure that these 2 boxes are checked (ticked):
      Update Malwarebytes' Anti-Malware
      Launch Malwarebytes' Anti-Malware
  3. Malwarebytes' Anti-Malware will now check for updates. If your firewall prompts, please allow it. If you can't update it, select the Update tab. Under Update Mirror, select one of the websites and click on Check for Updates.
  4. Select the Scanner tab. Click on Perform full scan, then click on Scan.
  5. Leave the default options as it is and click on Start Scan.
  6. When done, you will be prompted. Click OK, then click on Show Results.
  7. Check (tick) all items except items in the C:\System Volume Information folder and click on Remove Selected.
  8. After it has removed the items, Notepad will open. Please post this log in your next reply. You can also find the log in the Logs tab. The bottom most log is the latest.


Next,
Download and run OTL

Download OTL by Old Timer and save it to your Desktop.
  • Double click on OTL.exe to run it.
  • Under Extra Registry section, select Use SafeList.
  • Click the Scan All Users checkbox.
  • Click on Run Scan at the top left hand corner.
  • When done, two Notepad files will open.
    • OTL.txt <-- Will be opened
    • Extras.txt <-- Will be minimized
  • Please post the contents of these 2 Notepad files in your next reply.

Please post the following:
  • The Malwarebytes' log
  • The OTL.txt logfile
  • The Extras.txt logfile
User avatar
Carolyn
MRU Emeritus
MRU Emeritus
 
Posts: 4701
Joined: April 18th, 2007, 9:36 am
Location: Maine

Re: I Got Spigot on Win 7

Unread postby ejack1 » March 6th, 2011, 12:09 pm

Hi Carolyn:

So let me get this right: you now have now grown the list of what you consider to be "pirated" software to:

Call of Duty(R) 4 - Modern Warfare(TM)
Call of Duty(R) 4 - Modern Warfare(TM) 1.7 Patch
Call of Duty: Black Ops
Call of Duty: Black Ops - Multiplayer

Along with:
IObit Toolbar v4.3
Punkbuster

- AS I mentioned, The COD games are legal, purchased games: One from Best Buy (in which I can provide the sale receipt), the other from Steam (which also is a legal company to purchase games from) which you can see. The 1.7 patch is a game theater-map update.

- IOBIT is a company that makes free version software to help computer efficiency

- and Punkbuster is a well known gaming utility that prevents online cheating in games and is required by the game manufacturer and host to play. It is a hard sell to accuse this fine utility as being spyware. It's purpose to keep gaming honest and fair.

I am totally confused now. With respect, can you put us in touch with the Chief Admin in charge of this site? I think you and are having trouble understanding one another. It appears that you may not be familiar games and various legitimate utilities and are making well intended, yet excessive judgments and are mis-interpreting the goals and rules of this forum and service. I truly mean no disrespect, but something appears to be way off here.

Can you help me resolve this please. I need help

Sincerely,
Erik
ejack1
Active Member
 
Posts: 11
Joined: July 13th, 2008, 6:27 pm

Re: I Got Spigot on Win 7

Unread postby Carolyn » March 6th, 2011, 1:46 pm

IObit Toolbar, Dealio Toolbar, SearchSettings... all developed by Spigot, inc.

Erik wrote:when I start my machine, I get a notice that "Search from Spigot, Inc." was prevented from changing my browser settings.


I recommended uninstalling IObit toolbar because it may very well be the culprit here.

By the way, IObit's reputation is questionable, at best.
IObit accused of stealing from Malwarebytes

I did not suggest in any way that your installation of Punkbuster was illegal. You should be informed that malware removal tools may identify the program as spyware and that you might want to uninstall the program and reinstall it after the cleaning process is completed.

There are entries in your logs that indicate the Call of Duty programs may not be legally installed. You are welcome to contact the forum Adminstrators (link: The team) but I can tell you that they have already reviewed your logs and agree with my analysis.
User avatar
Carolyn
MRU Emeritus
MRU Emeritus
 
Posts: 4701
Joined: April 18th, 2007, 9:36 am
Location: Maine

Re: I Got Spigot on Win 7

Unread postby ejack1 » March 6th, 2011, 3:41 pm

Hi Carolyn:

I PM'd NonSuch about this and received the party line regarding your view which is fine.
I maintain that the Call of Duty series of games is a widely regarded and distributed game series and my purchase of them was normal and legal from a bona fide retail store (Best Buy and Steam) which I offered to show proof of. I'm not going to uninstall them and the idea that you consider them as "pirated" is concerning to me on several fronts; same goes with Punkbuster which is a well known utility for keeping cheaters out of gaming. I would suggest that this gaming element might be something deserving of further research on your end; just a suggestion. The issue was not present subsequent to install of these games which you could see was some time ago.

I agree that the culprit of my recent issue may have been IOBIT which I believe somehow attached itself to the drivers I installed. It is not something I sought out to use directly and did not know it was there until I checked the programs list. I un-installed it.

Thanks for your attention to this.

Sincerely,

Erik
ejack1
Active Member
 
Posts: 11
Joined: July 13th, 2008, 6:27 pm

Re: I Got Spigot on Win 7

Unread postby Carolyn » March 6th, 2011, 3:56 pm

This topic is now closed.
User avatar
Carolyn
MRU Emeritus
MRU Emeritus
 
Posts: 4701
Joined: April 18th, 2007, 9:36 am
Location: Maine
Advertisement
Register to Remove


  • Similar Topics
    Replies
    Views
    Last post

Return to Infected? Virus, malware, adware, ransomware, oh my!



Who is online

Users browsing this forum: No registered users and 37 guests

Contact us:

Advertisements do not imply our endorsement of that product or service. Register to remove all ads. The forum is run by volunteers who donate their time and expertise. We make every attempt to ensure that the help and advice posted is accurate and will not cause harm to your computer. However, we do not guarantee that they are accurate and they are to be used at your own risk. All trademarks are the property of their respective owners.

Member site: UNITE Against Malware